Overview

  • Product name

  • Description

    Rabbit polyclonal to P2X7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Synthetic peptide within Human P2X7 aa 21-70 (N terminal). The exact sequence is proprietary.
    Sequence:

    IQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAE


    Database link: Q99572

  • Positive control

    • Jurkat cell lysate; Human kidney tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab48871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 31 kDa (predicted molecular weight: 31 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500

Target

  • Function

    Receptor for ATP that acts as a ligand-gated ion channel. Responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Could function in both fast synaptic transmission and the ATP-mediated lysis of antigen-presenting cells.
  • Tissue specificity

    Widely expressed with highest levels in brain and immune tissues.
  • Sequence similarities

    Belongs to the P2X receptor family.
  • Post-translational
    modifications

    Phosphorylation results in its inactivation.
    ADP-ribosylation at Arg-125 is necessary and sufficient to activate P2RX7 and gate the channel.
    Palmitoylation of several cysteines in the C-terminal cytoplasmic tail is required for efficient localization to cell surface.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP receptor antibody
    • P2rx7 antibody
    • P2RX7_HUMAN antibody
    • P2X purinoceptor 7 antibody
    • P2X7 antibody
    • P2Z receptor antibody
    • Purinergic receptor antibody
    • purinergic receptor P2X, ligand gated ion channel, 7 antibody
    see all

Images

  • Anti-P2X7 antibody (ab48871) at 1.25 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.

    Predicted band size: 31 kDa
    Observed band size: 31 kDa



    Antibody diluted in 5% skim milk / PBS buffer; Gel concentration 12%
  • Ab48871 at 4.0µg/ml staining paraffin embedded human kidney. Magnification x400. Arrows indicate staining of epithelial cells of renal tubule.

References

This product has been referenced in:

  • Xu XY  et al. Role of the P2X7 receptor in inflammation-mediated changes in the osteogenesis of periodontal ligament stem cells. Cell Death Dis 10:20 (2019). Read more (PubMed: 30622236) »
  • Cui BW  et al. Thymoquinone Attenuates Acetaminophen Overdose-Induced Acute Liver Injury and Inflammation Via Regulation of JNK and AMPK Signaling Pathway. Am J Chin Med 47:577-594 (2019). Read more (PubMed: 30974967) »
See all 7 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

Application
Western blot
Sample
Mouse Tissue lysate - whole (Liver and Brain)
Gel Running Conditions
Non-reduced Denaturing (12% gel)
Loading amount
30 µg
Treatment
24hrs after CLP (Cecal Ligation and Puncture)
Specification
Liver and Brain
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Dr. Zhenyu Wu

Verified customer

Submitted Nov 07 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up