Overview

  • Product name
  • Description
    Mouse polyclonal to P2Y1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Guinea pig, Cow
  • Immunogen

    Full length protein corresponding to Human P2Y1 aa 1-373.
    Sequence:

    MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQ FYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLY VLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRY SGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTI TCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKDLD NSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANL QSKSEDMTLNILPEFKQNGDTSL

  • Positive control
    • P2Y1 transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab168918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa.

Target

Images

  • All lanes : Anti-P2Y1 antibody (ab168918) at 1 µg/ml

    Lane 1 : P2Y1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 42 kDa

References

ab168918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Human Cell lysate - whole cell (P2Y1-transfected cells, HEK293 cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
50 µg
Specification
P2Y1-transfected cells, HEK293 cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Oct 27 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up