Anti-P2Y13 antibody [2H1G9] (ab175365)
Key features and details
- Mouse monoclonal [2H1G9] to P2Y13
- Suitable for: WB, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-P2Y13 antibody [2H1G9]
See all P2Y13 primary antibodies -
Description
Mouse monoclonal [2H1G9] to P2Y13 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human P2Y13 aa 1-49. Expressed in E coli
Sequence:MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPA
Database link: Q9BPV8 -
Positive control
- HepG2 cells; Human P2Y13 recombinant protein; P2Y13 (aa 1–49)-hIgGFc transfected HEK293 cell lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
0.5% protein stabilizer -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
2H1G9 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175365 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 40 kDa.
|
|
Flow Cyt |
1/200 - 1/400.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 40 kDa. |
Flow Cyt
1/200 - 1/400. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Receptor for ADP. Coupled to G(i)-proteins. May play a role in hematopoiesis and the immune system. -
Tissue specificity
Strong expression in spleen and adult brain. Lower expression in placenta, lung, liver, spinal cord, thymus, small intestine, uterus, stomach, testis, fetal brain, and adrenal gland. Not detected in pancreas, heart, kidney, skeletal muscle, ovary or fetal aorta. Clearly detected in lymph node and bone marrow, weakly detected in peripheral blood mononuclear cells (PBMC) and in peripheral blood leukocytes (PBL), but not detected in polymorphonuclear cells (PMN). In the brain, detected in all brain regions examined. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 53829 Human
- Omim: 606380 Human
- SwissProt: Q9BPV8 Human
- Unigene: 546396 Human
-
Form
There are 2 isoforms produced by alternative splicing. -
Alternative names
- P2RY13 antibody
- FKSG77 antibody
- G protein coupled receptor 86 antibody
see all
Images
-
All lanes : Anti-P2Y13 antibody [2H1G9] (ab175365) at 1/500 dilution
Lane 1 : non transfected HEK293 cell lysate.
Lane 2 : P2Y13 (aa 1–49)-hIgGFc transfected HEK293 cell lysate.
Predicted band size: 40 kDa -
Anti-P2Y13 antibody [2H1G9] (ab175365) at 1/500 dilution + Human P2Y13 recombinant protein
Predicted band size: 40 kDaExpected MW is 31.6 kDa
-
Flow cytometric analysis of HepG2 cells labeling P2Y13 using ab175365 at 1/200 dilution (green), and negative control (purple).
Datasheets and documents
-
Datasheet download
References (0)
ab175365 has not yet been referenced specifically in any publications.