Overview

  • Product name
    Anti-P2Y13 antibody [2H1G9]
    See all P2Y13 primary antibodies
  • Description
    Mouse monoclonal [2H1G9] to P2Y13
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, Flow Cyt, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human P2Y13 aa 1-49. Expressed in E coli
    Sequence:

    MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPA


    Database link: Q9BPV8

  • Positive control
    • HepG2 cells; Human P2Y13 recombinant protein; P2Y13 (aa 1–49)-hIgGFc transfected HEK293 cell lysate.
  • General notes

    Previously labelled as GPCR GPR86. 

Properties

Applications

Our Abpromise guarantee covers the use of ab175365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 40 kDa.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

ELISA 1/10000.

Target

  • Function
    Receptor for ADP. Coupled to G(i)-proteins. May play a role in hematopoiesis and the immune system.
  • Tissue specificity
    Strong expression in spleen and adult brain. Lower expression in placenta, lung, liver, spinal cord, thymus, small intestine, uterus, stomach, testis, fetal brain, and adrenal gland. Not detected in pancreas, heart, kidney, skeletal muscle, ovary or fetal aorta. Clearly detected in lymph node and bone marrow, weakly detected in peripheral blood mononuclear cells (PBMC) and in peripheral blood leukocytes (PBL), but not detected in polymorphonuclear cells (PMN). In the brain, detected in all brain regions examined.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Form
    There are 2 isoforms produced by alternative splicing.
  • Alternative names
    • P2RY13 antibody
    • FKSG77 antibody
    • G protein coupled receptor 86 antibody
    • G protein coupled receptor 94 antibody
    • G-protein coupled receptor 86 antibody
    • G-protein coupled receptor 94 antibody
    • GPCR GPR86 antibody
    • GPCR1 antibody
    • GPR86 antibody
    • GPR94 antibody
    • HGNC:13661 antibody
    • P2RY13 antibody
    • P2Y purinoceptor 13 antibody
    • P2Y13 antibody
    • P2Y13_HUMAN antibody
    • Purinergic receptor P2Y G protein coupled 13 antibody
    • SP174 antibody
    see all

Images

  • All lanes : Anti-P2Y13 antibody [2H1G9] (ab175365) at 1/500 dilution

    Lane 1 : non transfected HEK293 cell lysate.
    Lane 2 : P2Y13 (aa 1–49)-hIgGFc transfected HEK293 cell lysate.

    Predicted band size: 40 kDa

  • Anti-P2Y13 antibody [2H1G9] (ab175365) at 1/500 dilution + Human P2Y13 recombinant protein

    Predicted band size: 40 kDa



    Expected MW is 31.6 kDa

  • Flow cytometric analysis of HepG2 cells labeling P2Y13 using ab175365 at 1/200 dilution (green), and negative control (purple).

References

ab175365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up