For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    p2y13-antibody-2h1g9-ab175365.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurotransmission Receptors / Channels GPCR More GPCR
Share by email

Anti-P2Y13 antibody [2H1G9] (ab175365)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-P2Y13 antibody [2H1G9] (ab175365)
  • Western blot - Anti-P2Y13 antibody [2H1G9] (ab175365)
  • Flow Cytometry - Anti-P2Y13 antibody [2H1G9] (ab175365)

Key features and details

  • Mouse monoclonal [2H1G9] to P2Y13
  • Suitable for: WB, Flow Cyt
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-P2Y13 antibody [2H1G9]
    See all P2Y13 primary antibodies
  • Description

    Mouse monoclonal [2H1G9] to P2Y13
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human P2Y13 aa 1-49. Expressed in E coli
    Sequence:

    MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPA


    Database link: Q9BPV8
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HepG2 cells; Human P2Y13 recombinant protein; P2Y13 (aa 1–49)-hIgGFc transfected HEK293 cell lysate.
  • General notes

    Previously labelled as GPCR GPR86. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    0.5% protein stabilizer
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    2H1G9
  • Isotype

    IgG1
  • Research areas

    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • GPCR
    • More GPCR
    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • GPCR

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)

Applications

Our Abpromise guarantee covers the use of ab175365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 40 kDa.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Receptor for ADP. Coupled to G(i)-proteins. May play a role in hematopoiesis and the immune system.
  • Tissue specificity

    Strong expression in spleen and adult brain. Lower expression in placenta, lung, liver, spinal cord, thymus, small intestine, uterus, stomach, testis, fetal brain, and adrenal gland. Not detected in pancreas, heart, kidney, skeletal muscle, ovary or fetal aorta. Clearly detected in lymph node and bone marrow, weakly detected in peripheral blood mononuclear cells (PBMC) and in peripheral blood leukocytes (PBL), but not detected in polymorphonuclear cells (PMN). In the brain, detected in all brain regions examined.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Target information above from: UniProt accession Q9BPV8 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 53829 Human
    • Omim: 606380 Human
    • SwissProt: Q9BPV8 Human
    • Unigene: 546396 Human
    • Form

      There are 2 isoforms produced by alternative splicing.
    • Alternative names

      • P2RY13 antibody
      • FKSG77 antibody
      • G protein coupled receptor 86 antibody
      • G protein coupled receptor 94 antibody
      • G-protein coupled receptor 86 antibody
      • G-protein coupled receptor 94 antibody
      • GPCR GPR86 antibody
      • GPCR1 antibody
      • GPR86 antibody
      • GPR94 antibody
      • HGNC:13661 antibody
      • P2RY13 antibody
      • P2Y purinoceptor 13 antibody
      • P2Y13 antibody
      • P2Y13_HUMAN antibody
      • Purinergic receptor P2Y G protein coupled 13 antibody
      • SP174 antibody
      see all

    Images

    • Western blot - Anti-P2Y13 antibody [2H1G9] (ab175365)
      Western blot - Anti-P2Y13 antibody [2H1G9] (ab175365)
      All lanes : Anti-P2Y13 antibody [2H1G9] (ab175365) at 1/500 dilution

      Lane 1 : non transfected HEK293 cell lysate.
      Lane 2 : P2Y13 (aa 1–49)-hIgGFc transfected HEK293 cell lysate.

      Predicted band size: 40 kDa

    • Western blot - Anti-P2Y13 antibody [2H1G9] (ab175365)
      Western blot - Anti-P2Y13 antibody [2H1G9] (ab175365)
      Anti-P2Y13 antibody [2H1G9] (ab175365) at 1/500 dilution + Human P2Y13 recombinant protein

      Predicted band size: 40 kDa



      Expected MW is 31.6 kDa

    • Flow Cytometry - Anti-P2Y13 antibody [2H1G9] (ab175365)
      Flow Cytometry - Anti-P2Y13 antibody [2H1G9] (ab175365)

      Flow cytometric analysis of HepG2 cells labeling P2Y13 using ab175365 at 1/200 dilution (green), and negative control (purple).

    Protocols

    • Flow cytometry protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab175365? Please let us know so that we can cite the reference in this datasheet.

    ab175365 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab175365.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.