Overview

  • Product name

  • Description

    Rabbit polyclonal to P2Y14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human P2Y14 aa 256-305 (C terminal).
    Sequence:

    YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI


    Database link: NP_055694

  • Positive control

    • MDA-MB-435S cell lysate
  • General notes

    Previously labelled as GPCR GPR105. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab135323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa.

Target

  • Function

    Receptor for UDP-glucose and other UDP-sugar coupled to G-proteins. Not activated by ATP, ADP, UTP or ATP.
  • Tissue specificity

    Highest expression in the placenta, adipose tissue, stomach and intestine, intermediate levels in the brain, spleen, lung and heart, lowest levels in the kidney.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • A330108O13Rik antibody
    • G protein coupled receptor for UDP-glucose antibody
    • G protein-coupled receptor 105 antibody
    • G protein-coupled receptor VTR 15-20 antibody
    • G-protein coupled receptor 105 antibody
    • GPCR GPR105 antibody
    • GPR105 antibody
    • KIAA0001 antibody
    • P2RY14 antibody
    • P2Y purinoceptor 14 antibody
    • P2Y(14) receptor antibody
    • P2Y14 antibody
    • P2Y14 receptor antibody
    • P2Y14_HUMAN antibody
    • Purinergic receptor P2Y G protein coupled 14 antibody
    • Similar to TYPE-1 Angiotensin II receptor antibody
    • UDP-glucose receptor antibody
    see all

Images

  • Anti-P2Y14 antibody (ab135323) at 1 µg/ml + MDA-MB-435S cell lysate at 10 µg

    Predicted band size: 39 kDa

References

ab135323 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up