Overview

  • Product name

  • Description

    Rabbit polyclonal to p37
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human p37 aa 73-290. (BC000861).
    Sequence:

    VRVDGIAWSPETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEG HTDFINGLVFDPKEGQEIASVSDDHTCRIWNLEGVQTAHFVLHSPGMSVC WHPEETFKLMVAEKNGTIRFYDLLAQQAILSLESEQVPLMSAHWCLKNTF KVGAVAGNDWLIWDITRSSYPQNKRPVHMDRACLFRWSTISENLFATTGY PGKMASQFQIHHLGHPQP


    Database link: Q8NFH4

  • Positive control

    • A549 and SK-HEP-1 cell lysates.
  • General notes

    Protein previously labeled as NUP37.

Properties

Applications

Our Abpromise guarantee covers the use of ab201161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 37 kDa.

Target

Images

  • All lanes : Anti-p37 antibody (ab201161) at 1/500 dilution

    Lane 1 : A549 cell lysate
    Lane 2 : SK-HEP-1 cell lysate

    Predicted band size: 37 kDa

References

ab201161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Mouse Tissue lysate - whole (heart (from three different mice 1,2,3))
Gel Running Conditions
Reduced Denaturing (Bolt 4-12% bis tris plus (Invitrogen))
Loading amount
80 µg
Specification
heart (from three different mice 1,2,3)
Blocking step
BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted May 30 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up