Overview

  • Product name

  • Description

    Rabbit polyclonal to p37
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human p37 aa 242-326.
    Sequence:

    YPQNKRPVHMDRACLFRWSTISENLFATTGYPGKMASQFQIHHLGHPQPI LMGSVAVGSGLSWHRTLPLCVIGGDHKLLFWVTEV


    Database link: Q8NFH4

  • Positive control

    • RT4 and U251 MG cell line lysates; Human tonsil tissue lysate; U251 MG cells.
  • General notes

    Protein previously labeled as NUP37.

Properties

Applications

Our Abpromise guarantee covers the use of ab220675 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 37 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

Images

  • All lanes : Anti-p37 antibody (ab220675) at 1/100 dilution

    Lane 1 : RT4 cell line lysate
    Lane 2 : U251 MG cell line lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 37 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U251 MG cells labeling p37 with ab220675 at 4 µg/ml (green).

References

ab220675 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220675.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up