Overview

  • Product name

  • Description

    Rabbit polyclonal to p38IP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human p38IP aa 295-389.
    Sequence:

    RSPCNLAIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAG TQYQKTKLTILQSLGDPLYYGKIQPCKADEESDSQMSPSHSSTDD

  • Positive control

    • Human colon tissue.
  • General notes

    Previously labelled as FAM48A.

Properties

Applications

Our Abpromise guarantee covers the use of ab122518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250.
IHC-P 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Required for MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) activation during gastrulation. Required for down-regulation of E-cadherin during gastrulation by regulating E-cadherin protein level downstream from NCK-interacting kinase (NIK) and independently of the regulation of transcription by Fgf signaling and Snail (By similarity). Required for starvation-induced ATG9A trafficking during autophagy.
  • Tissue specificity

    Highly expressed in testis, moderately in brain and pituitary gland. Expressed in several fetal tissues, including lung, brain, thymus and kidney. Expression is down-regulated in malignant prostate tissues.
  • Sequence similarities

    Belongs to the FAM48 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AA667204 antibody
    • AI450544 antibody
    • bA421P11.4 antibody
    • C13 antibody
    • C13orf19 antibody
    • D3Ertd300e antibody
    • FA48A_HUMAN antibody
    • FAM48A antibody
    • FP757 antibody
    • p38-interacting protein antibody
    • p38IP antibody
    • Protein FAM48A antibody
    • RGD1307812 antibody
    • SPT20 antibody
    see all

Images

  • Lanes 2-3 : Anti-p38IP antibody (ab122518)

    Lane 1 : Marker
    Lane 2 : HEK293T cell lysate - vector only transfected
    Lane 3 : HEK293T cell lysate - overexpressing p38IP with a C-terminal myc-DDK tag (~3.1kDa)
  • ab122518 at 1/1000 dilution staining p38IP in Paraffin-embedded Human Colon tissue by Immunohistochemistry.

References

ab122518 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up