Overview

  • Product name

  • Description

    Rabbit polyclonal to p40-phox
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse p40-phox aa 111-339. (Expressed in E.coli)
    Sequence:

    AYMKNLLSLPVCVLMDPDVRIFFYQSAYDAEQVPQALRRLRPRTRKIKGV SPQGAIMDRMEAPRAEALFDFTGNSKLELSFKAGDVIFLLSKINKDWLEG TSQGATGIFPGSFVKILKDFPEDEDTTNWLRCYFYEDTGKTIKDIAVEED LSSTPLFKDLLALMRREFQREDIALSYQDAEGDLVRLLSDEDVGLMVKQA RGLPSQKRLFPWKLHVTQKDNYSVYNTVP


    Database link: P97369

  • Positive control

    • IHC-P: Mouse liver, spleen and kidney tissues. WB: Recombinant mouse p40-phox protein; Mouse spleen lysate.
  • General notes

    Previously labelled as NCF4. 

Properties

Applications

Our Abpromise guarantee covers the use of ab231639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 39 kDa.

Target

  • Function

    Component of the NADPH-oxidase, a multicomponent enzyme system responsible for the oxidative burst in which electrons are transported from NADPH to molecular oxygen, generating reactive oxidant intermediates. It may be important for the assembly and/or activation of the NADPH-oxidase complex.
  • Tissue specificity

    Expression is restricted to hematopoietic cells.
  • Sequence similarities

    Contains 1 PX (phox homology) domain.
    Contains 1 SH3 domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CGD3 antibody
    • MGC3810 antibody
    • NCF 4 antibody
    • NCF antibody
    • NCF-4 antibody
    • Ncf4 antibody
    • NCF4_HUMAN antibody
    • Neutrophil cytosol factor 4 antibody
    • Neutrophil cytosolic factor 4 antibody
    • Neutrophil NADPH oxidase factor 4 antibody
    • p40-phox antibody
    • p40phox antibody
    • SH3 and PX domain-containing protein 4 antibody
    • SH3PXD4 antibody
    see all

Images

  • Anti-p40-phox antibody (ab231639) at 3 µg/ml + Mouse spleen lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 39 kDa

  • Anti-p40-phox antibody (ab231639) at 3 µg/ml + Recombinant mouse p40-phox protein.

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 39 kDa

  • Paraffin-embedded mouse kidney tissue stained for p40-phox using ab231639 at 20 µg/ml in immunohistochemical analysis.

  • Paraffin-embedded mouse spleen tissue stained for p40-phox using ab231639 at 20 µg/ml in immunohistochemical analysis.

  • Paraffin-embedded mouse liver tissue stained for p40-phox using ab231639 at 20 µg/ml in immunohistochemical analysis.

References

ab231639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up