Overview

  • Product name

  • Description

    Rabbit polyclonal to p46
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human p46 aa 5-95.
    Sequence:

    SLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRF DARQKIGLSDARLKLGVKDAREKLLQKDARFRIKGKVQDAR

  • Positive control

    • Human testis tissue; RT4 and U251 MG cell lysates; A431 cells.
  • General notes

    Previously labelled as SKAR. 

Properties

Applications

Our Abpromise guarantee covers the use of ab121568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500.
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Is involved in regulation of translation. Is preferentially associated with CBC-bound spliced mRNA-protein complexes during the pioneer round of mRNA translation. Contributes to enhanced translational efficiency of spliced over nonspliced mRNAs. Recruits activated ribosomal protein S6 kinase beta-1 I/RPS6KB1 to newly synthesized mRNA.
  • Sequence similarities

    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Nucleus speckle. Cytoplasm. Nucleocytoplasmic shuttling protein.
  • Information by UniProt
  • Database links

  • Alternative names

    • 46 kDa DNA polymerase delta interaction protein antibody
    • DNA polymerase delta interacting protein 3 antibody
    • KIAA1649 antibody
    • P46 antibody
    • PDIP3_HUMAN antibody
    • PDIP46 antibody
    • POLDIP3 antibody
    • Polymerase (DNA-directed), delta interacting protein 3 antibody
    • Polymerase delta interacting protein 46 antibody
    • Polymerase delta-interacting protein 3 antibody
    • RNA-binding protein P46 antibody
    • S6K1 Aly/REF-like target antibody
    • SKAR antibody
    see all

Images

  • Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
    Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
  • ab121568 at 1/20 dilution staining p46 in Paraffin-embedded Human Testis tissue by Immunohistochemistry.

  • ab121568 at 4 µg/ml staining p46 in PFA/Triton X-100 fixed/permeabilized A431 cells by Immunofluorescence (green).

  • All lanes : Anti-p46 antibody (ab121568) at 1/250 dilution

    Lane 1 : RT4 lysate
    Lane 2 : Human liver lysate
    Lane 3 : U251 MG lysate
    Lane 4 : Human plasma
    Lane 5 : Human tonsil lysate

    Developed using the ECL technique.

References

ab121568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up