Overview

  • Product name

  • Description

    Rabbit polyclonal to P4HA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human P4HA1 aa 179-320.
    Sequence:

    DYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLT KKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGV AVDYLPERQKYEMLCRGEGIKMTPRRQKKLFCRYHDGNRNPK


    Database link: P13674

  • Positive control

    • ICC/IF: U-2 OS cells. WB: PC-3 cell lysate. RT4, NBT-II and U-251 MG cell lysate. IHC-P: Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab244400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for P4HA1 (green) using ab244400 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human placenta tissue stained for P4HA1 using ab244400 at 1/1000 dilution in immunohistochemical analysis.
  • Paraffin-embedded human pancreas tissue stained for P4HA1 using ab244400 at 1/1000 dilution in immunohistochemical analysis.

    Low expression as expected.

  • All lanes : Anti-P4HA1 antibody (ab244400) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (Mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II (Rat cell line) cell lysate
  • All lanes : Anti-P4HA1 antibody (ab244400) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
  • All lanes : Anti-P4HA1 antibody (ab244400) at 0.4 µg/ml

    Lane 1 : PC-3 (Human prostate adenocarcinoma cell line) cell lysate
    Lane 2 : HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate

References

ab244400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up