Overview

  • Product name

  • Description

    Rabbit polyclonal to P4HA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human P4HA2 aa 207-520. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    SQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEE EREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQ KRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEI AKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHIT GLTVKTAELLQVANYGVGGQYEPHFDFSRNDERDTFKHLGTGNRVATFLN YMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSGEGDYRTRHAACPV LVGCKWVSNKWFHE


    Database link: O15460

  • Positive control

    • ICC/IF: HeLa cells. IHC-P: Human pancreas tissue. WB: Recombinant human P4HA2 protein; HeLa and HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233197 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.
  • Sequence similarities

    Belongs to the P4HA family.
    Contains 1 Fe2OG dioxygenase domain.
    Contains 1 TPR repeat.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2-oxoglutarate-4-dioxygenase subunit alpha-2 antibody
    • 4 PH alpha 2 antibody
    • 4-PH alpha-2 antibody
    • C-P4Halpha(II) antibody
    • collagen prolyl 4-hydroxylase alpha(II) antibody
    • P4HA2 antibody
    • P4HA2_HUMAN antibody
    • procollagen proline, 2 oxoglutarate 4 dioxygenase (proline 4 hydroxylase), alpha polypeptide II antibody
    • procollagen proline, 2 oxoglutarate 4 dioxygenase alpha subunit, isoform 2 antibody
    • Procollagen-proline antibody
    • procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2 antibody
    • Prolyl 4 hydroxylase alpha 2 subunit antibody
    • Prolyl 4 hydroxylase subunit alpha 2 [Precursor] antibody
    • Prolyl 4-hydroxylase subunit alpha-2 antibody
    • Prolyl 4-hydroxylase, alpha polypeptide II antibody
    see all

Images

  • All lanes : Anti-P4HA2 antibody (ab233197) at 1 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for P4HA2 using ab233197 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for P4HA2 using ab233197 at 2 µg/ml in ICC/IF. FITC staining.

  • Anti-P4HA2 antibody (ab233197) at 2 µg/ml + Recombinant human P4HA2 protein

References

ab233197 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233197.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up