Overview

  • Product name

    Anti-p50 dynamitin antibody
    See all p50 dynamitin primary antibodies
  • Description

    Rabbit polyclonal to p50 dynamitin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human p50 dynamitin aa 50-320.
    Sequence:

    MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELTSTSVEHIIVNP NAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQ QKYQRLLHEVQELTTEVEKIKTTVKESATEEKLTPVLLAKQLAALKQQLV ASHLEKLLGPDAAINLTDPDGALAKRLLLQLEATKNSKGGSGGKTTGTPP DSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELETAVRCDQDAQNPLSA GLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKASV EDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLL THLDTTQQMI ANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKK LGK


    Database link: Q13561

  • Positive control

    • MCF7, A375 and Saos-2 cell line extracts.
  • General notes

    Previously labelled as Dynamitin. 

Properties

Applications

Our Abpromise guarantee covers the use of ab185928 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 44 kDa.
IHC-P 1/50 - 1/200.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Modulates cytoplasmic dynein binding to an organelle, and plays a role in prometaphase chromosome alignment and spindle organization during mitosis. Involved in anchoring microtubules to centrosomes. May play a role in synapse formation during brain development.
  • Sequence similarities

    Belongs to the dynactin subunit 2 family.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome. Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 50 kD dynein associated polypeptide antibody
    • 50 kDa dynein associated polypeptide antibody
    • 50 kDa dynein-associated polypeptide antibody
    • DCTN-50 antibody
    • DCTN2 antibody
    • DCTN2_HUMAN antibody
    • DCTN50 antibody
    • dynactin 2 (p50) antibody
    • dynactin 2 antibody
    • dynactin complex 50 kD subunit antibody
    • Dynactin complex 50 kDa subunit antibody
    • Dynactin subunit 2 antibody
    • DYNAMITIN antibody
    • p50 dynamitin antibody
    • RBP50 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab185928. Blue DAPI for nuclear staining.
  • All lanes : Anti-p50 dynamitin antibody (ab185928) at 1/500 dilution

    Lane 1 : MCF7 cell line extract
    Lane 2 : A375 cell line extract
    Lane 3 : Saos-2 cell line extract

    Predicted band size: 44 kDa

References

ab185928 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185928.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up