Overview

  • Product name

    Anti-p53 AIP1 antibody
  • Description

    Rabbit polyclonal to p53 AIP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human p53 AIP1 aa 90-124 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ


    Database link: Q9HCN2

  • Positive control

    • Human lung carcinoma tissue; moue spleen tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab217785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    May play an important role in mediating p53/TP53-dependent apoptosis.
  • Tissue specificity

    Only found to be expressed in thymus.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • p53 regulated apoptosis inducing protein 1 antibody
    • p53-regulated apoptosis-inducing protein 1 antibody
    • P53AIP 1 antibody
    • p53AIP1 antibody
    • TP53AIP 1 antibody
    • TP53AIP1 antibody
    • TPIP1_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung carcinoma tissue labeling p53 AIP1 with ab217785 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse spleen tissue labeling p53 AIP1 with ab217785 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217785 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up