Anti-p57 Kip2 antibody [KIP2/880] (ab220207)
Key features and details
- Mouse monoclonal [KIP2/880] to p57 Kip2
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG2b
Overview
-
Product name
Anti-p57 Kip2 antibody [KIP2/880]
See all p57 Kip2 primary antibodies -
Description
Mouse monoclonal [KIP2/880] to p57 Kip2 -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant full length protein corresponding to Human p57 Kip2.
Sequence:MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARL AELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC RLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPP VPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAP APAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRP AAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSA APGVGSVEQTPRKRLR
Database link: P49918-1 -
Positive control
- Human colon carcinoma and prostate carcinoma tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 0.05% BSA, PBS -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
ab220207 was purified from Bioreactor Concentrate by Protein A/G. -
Clonality
Monoclonal -
Clone number
KIP2/880 -
Isotype
IgG2b -
Light chain type
kappa -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220207 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 0.25 - 0.5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. (Primary incubation for 30 minutes at RT). |
Target
-
Function
Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life. -
Tissue specificity
Expressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. High levels are seen in the placenta while low levels are seen in the liver. -
Involvement in disease
Defects in CDKN1C are a cause of Beckwith-Wiedemann syndrome (BWS) [MIM:130650]. BWS is a genetically heterogeneous disorder characterized by anterior abdominal wall defects including exomphalos (omphalocele), pre- and postnatal overgrowth, and macroglossia. Additional less frequent complications include specific developmental defects and a predisposition to embryonal tumors.
Note=Defects in CDKN1C are involved in tumor formation. -
Sequence similarities
Belongs to the CDI family. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 1028 Human
- Entrez Gene: 12577 Mouse
- Omim: 600856 Human
- SwissProt: P49918 Human
- SwissProt: P49919 Mouse
- Unigene: 106070 Human
- Unigene: 168789 Mouse
-
Alternative names
- Beckwith Wiedemann syndrome antibody
- BWCR antibody
- BWS antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p57 Kip2 antibody [KIP2/880] (ab220207)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded human prostate carcinoma tissue labeling p57 Kip2 with ab220207 at 0.5 µg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p57 Kip2 antibody [KIP2/880] (ab220207)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded human colon carcinoma tissue labeling p57 Kip2 with ab220207 at 0.5 µg/ml.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab220207 has not yet been referenced specifically in any publications.