Anti-p57 Kip2 antibody [KIP2/880] (ab220207)

Submit a review Submit a question
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p57 Kip2 antibody [KIP2/880] (ab220207)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p57 Kip2 antibody [KIP2/880] (ab220207)

Key features and details

  • Mouse monoclonal [KIP2/880] to p57 Kip2
  • Suitable for: IHC-P
  • Reacts with: Human
  • Isotype: IgG2b

Overview

  • Product name

    Anti-p57 Kip2 antibody [KIP2/880]
    See all p57 Kip2 primary antibodies

  • Description

    Mouse monoclonal [KIP2/880] to p57 Kip2

  • Host species

    Mouse

  • Tested applications

    Suitable for: IHC-Pmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse

  • Immunogen

    Recombinant full length protein corresponding to Human p57 Kip2.
    Sequence:

    MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARL AELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC RLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPP VPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAP APAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRP AAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSA APGVGSVEQTPRKRLR


    Database link: P49918-1
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Human colon carcinoma and prostate carcinoma tissues.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab220207 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.25 - 0.5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

  • Function

    Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life.

  • Tissue specificity

    Expressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. High levels are seen in the placenta while low levels are seen in the liver.

  • Involvement in disease

    Defects in CDKN1C are a cause of Beckwith-Wiedemann syndrome (BWS) [MIM:130650]. BWS is a genetically heterogeneous disorder characterized by anterior abdominal wall defects including exomphalos (omphalocele), pre- and postnatal overgrowth, and macroglossia. Additional less frequent complications include specific developmental defects and a predisposition to embryonal tumors.
    Note=Defects in CDKN1C are involved in tumor formation.

  • Sequence similarities

    Belongs to the CDI family.

  • Cellular localization

    Nucleus.
  • Information by UniProt

  • Database links

    • Alternative names

      • Beckwith Wiedemann syndrome antibody
      • BWCR antibody
      • BWS antibody
      • CDKI antibody
      • CDKN 1C antibody
      • CDKN1C antibody
      • CDN1C_HUMAN antibody
      • Cyclin dependent kinase inhibitor 1C antibody
      • Cyclin dependent kinase inhibitor p57 antibody
      • Cyclin-dependent kinase inhibitor 1C antibody
      • Cyclin-dependent kinase inhibitor p57 antibody
      • KIP 2 antibody
      • KIP2 antibody
      • p57 antibody
      • p57 Kip 2 antibody
      • p57KIP2 antibody
      • WBS antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p57 Kip2 antibody [KIP2/880] (ab220207)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p57 Kip2 antibody [KIP2/880] (ab220207)

      Immunohistochemical analysis of formalin-fixed, paraffin-embedded human prostate carcinoma tissue labeling p57 Kip2 with ab220207 at 0.5 µg/ml.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p57 Kip2 antibody [KIP2/880] (ab220207)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p57 Kip2 antibody [KIP2/880] (ab220207)

      Immunohistochemical analysis of formalin-fixed, paraffin-embedded human colon carcinoma tissue labeling p57 Kip2 with ab220207 at 0.5 µg/ml.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab220207? Please let us know so that we can cite the reference in this datasheet.

    ab220207 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab220207.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com