Overview

  • Product name

    Anti-p57 Kip2 antibody [KIP2/880] - BSA and Azide free
    See all p57 Kip2 primary antibodies
  • Description

    Mouse monoclonal [KIP2/880] to p57 Kip2 - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human p57 Kip2 aa 1-316.
    Sequence:

    MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARL AELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC RLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPP VPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAP APAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRP AAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSA APGVGSVEQTPRKRLR


    Database link: P49918

  • Positive control

    • LS174T, Raji, HT29, SK-BR3 cell lysates; Human colon and prostate carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab212257 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 0.5-1µg for 106 cells.

In 0.1ml.

ICC/IF Use a concentration of 0.5 - 1 µg/ml.
IHC-P Use a concentration of 0.25 - 0.5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life.
  • Tissue specificity

    Expressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. High levels are seen in the placenta while low levels are seen in the liver.
  • Involvement in disease

    Defects in CDKN1C are a cause of Beckwith-Wiedemann syndrome (BWS) [MIM:130650]. BWS is a genetically heterogeneous disorder characterized by anterior abdominal wall defects including exomphalos (omphalocele), pre- and postnatal overgrowth, and macroglossia. Additional less frequent complications include specific developmental defects and a predisposition to embryonal tumors.
    Note=Defects in CDKN1C are involved in tumor formation.
  • Sequence similarities

    Belongs to the CDI family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beckwith Wiedemann syndrome antibody
    • BWCR antibody
    • BWS antibody
    • CDKI antibody
    • CDKN 1C antibody
    • CDKN1C antibody
    • CDN1C_HUMAN antibody
    • Cyclin dependent kinase inhibitor 1C antibody
    • Cyclin dependent kinase inhibitor p57 antibody
    • Cyclin-dependent kinase inhibitor 1C antibody
    • Cyclin-dependent kinase inhibitor p57 antibody
    • KIP 2 antibody
    • KIP2 antibody
    • p57 antibody
    • p57 Kip 2 antibody
    • p57KIP2 antibody
    • WBS antibody
    see all

Images

  • Immunohistochemical analysis of Formalin-fixed, paraffin-embedded Human prostate carcinoma tissue labeling p57 Kip2 with ab212257 at 0.5µg/ml.

  • Immunohistochemical analysis of Formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling p57 Kip2 with ab212257 at 0.5µg/ml.

References

ab212257 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212257.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up