Overview

  • Product name

  • Description

    Rabbit polyclonal to P5CS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human P5CS aa 97-245.
    Sequence:

    SIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQN QLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHD EQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNVISVKD


    Database link: P54886

  • Positive control

    • WB: NIH/3T3, NBT-II and U-251 cell lysates. IHC-P: Human colon tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 87 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100

Target

  • Pathway

    Amino-acid biosynthesis; L-proline biosynthesis; L-glutamate 5-semialdehyde from L-glutamate: step 1/2.
    Amino-acid biosynthesis; L-proline biosynthesis; L-glutamate 5-semialdehyde from L-glutamate: step 2/2.
  • Involvement in disease

    Defects in ALDH18A1 are the cause of mental retardation-joint hypermobility-skin laxity with or without metabolic abnormalities (MRJHSL) [MIM:612652]. Clinical manifestations include microcephaly, progressive neurologic dysfunction, mental retardation, progeroid appearance, joint hypermobility, skin laxity and hyperelasticity, cataracts. Some patients manifest metabolic disturbances such as hyperammonemia, hypoornithinemia, hypocitrullinemia, hypoargininemia and hypoprolinemia.
  • Sequence similarities

    In the N-terminal section; belongs to the glutamate 5-kinase family.
    In the C-terminal section; belongs to the gamma-glutamyl phosphate reductase family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Form

    P5CS catalyzes the ATP- and NADPH-dependent conversion of L-glutamate to glutamic gamma-semialdehyde, which is the metabolic precursor for proline biosynthesis. There are 2 isoforms produced by alternative splicing.
  • Alternative names

    • 2810433K04Rik antibody
    • AI429789 antibody
    • Aldehyde dehydrogenase 18 family member A1 antibody
    • Aldehyde dehydrogenase 18A1 antibody
    • Aldehyde dehydrogenase family 18 member A1 antibody
    • ALDH18A1 antibody
    • Delta 1 pyrroline 5 carboxylate synthetase antibody
    • Delta1 pyrroline 5 carboxlate synthetase antibody
    • Gamma-glutamyl kinase antibody
    • Gamma-glutamyl phosphate reductase antibody
    • GK antibody
    • Glutamate-5-semialdehyde dehydrogenase antibody
    • Glutamyl-gamma-semialdehyde dehydrogenase antibody
    • GPR antibody
    • GSAS antibody
    • MGC117316 antibody
    • MGC32233 antibody
    • P5CS antibody
    • P5CS_HUMAN antibody
    • PYCS antibody
    • Pyrroline 5 carboxylate synthetase (glutamate gamma semialdehyde synthetase) antibody
    see all

Images

  • All lanes : Anti-P5CS antibody (ab223713) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 87 kDa

  • Paraffin embedded sections of human colon were stained for P5CS with ab223713 at 1/20 dilution in immunohistochemical analysis.

  • All lanes : Anti-P5CS antibody (ab223713) at 1/20 dilution

    Lane 1 : Caco-2 cell lysate transfected with control siRNA
    Lane 2 : Caco-2 cell lysate transfected with target specific siRNA probe #1
    Lane 3 : Caco-2 cell lysate transfected with target specific siRNA probe #2

    Predicted band size: 87 kDa

  • All lanes : Anti-P5CS antibody (ab223713) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat bladder tumor cell line) cell lysate

    Predicted band size: 87 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for P5CS (green) using ab223713 at 4 µg/ml in ICC/IF.

References

ab223713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up