Overview

  • Product name

    Anti-p75 NGF Receptor antibody [8J2] (FITC)
    See all p75 NGF Receptor primary antibodies
  • Description

    Mouse monoclonal [8J2] to p75 NGF Receptor (FITC)
  • Host species

    Mouse
  • Conjugation

    FITC. Ex: 493nm, Em: 528nm
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human p75 NGF Receptor aa 29-250 (extracellular).
    Sequence:

    KEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVS ATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVC EAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLR ECTRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTV AGVVTTVMGSSQPVVTRGTTDN


    Database link: P08138

  • Positive control

    • ICC/IF: SH-SY5Y cells.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab245132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 5 µg/ml.

Light fixation only or unfixed works best. Epitope is sensitive to fixation.

Target

  • Function

    Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neural cells.
  • Sequence similarities

    Contains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • Domain

    Death domain is responsible for interaction with RANBP9.
    The extracellular domain is responsible for interaction with NTRK1.
  • Post-translational
    modifications

    N- and O-glycosylated.
    O-linked glycans consist of Gal(1-3)GalNAc core elongated by 1 or 2 NeuNAc.
    Phosphorylated on serine residues.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD271 antibody
    • CD271 antigen antibody
    • Gp80 LNGFR antibody
    • Gp80-LNGFR antibody
    • Low affinity nerve growth factor receptor antibody
    • Low affinity neurotrophin receptor p75NTR antibody
    • Low-affinity nerve growth factor receptor antibody
    • Nerve growth factor receptor antibody
    • Nerve growth factor receptor TNFR superfamily member 16 antibody
    • NGF receptor antibody
    • Ngfr antibody
    • p75 ICD antibody
    • p75 Neurotrophin receptor antibody
    • p75 NTR antibody
    • p75(NTR) antibody
    • p75NTR antibody
    • TNFR Superfamily Member 16 antibody
    • TNFRSF16 antibody
    • TNR16_HUMAN antibody
    • Tumor necrosis factor receptor superfamily member 16 antibody
    see all

Images

  • SH-SY5Y (human neuroblastoma cell line from bone marrow) cells labeling p75 NGF Receptor using ab245132 at 2 µg/ml (green) in ICC/IF.

    Left panel: Brightfield.

    Middle panel: FITC.

    Right panel: Merged image.

References

ab245132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up