For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    p95nbs1-antibody-7e4a2-ab181729.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling DNA / RNA DNA Damage & Repair Non Homol. End Joining
Share by email
Validated using a knockout cell line

Anti-p95/NBS1 antibody [7E4A2] (ab181729)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
  • Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
  • Immunocytochemistry/ Immunofluorescence - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
  • Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
  • Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
  • Flow Cytometry - Anti-p95/NBS1 antibody [7E4A2] (ab181729)

Key features and details

  • Mouse monoclonal [7E4A2] to p95/NBS1
  • Suitable for: Flow Cyt, IHC-P, WB, ICC/IF
  • Knockout validated
  • Reacts with: Rat, Human
  • Isotype: IgG2a

You may also be interested in

Primary
Product image
Anti-MPP1 antibody [EPR5864] (ab133500)
Protein
Product image
Recombinant Human p95/NBS1 protein (ab158956)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-p95/NBS1 antibody [7E4A2]
    See all p95/NBS1 primary antibodies
  • Description

    Mouse monoclonal [7E4A2] to p95/NBS1
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human p95/NBS1 aa 467-615. Expressed in E. Coli.
    Sequence:

    ERDEENQEMSSCKSARIETSCSLLEQTQPATPSLWKNKEQHLSENEPVDT NSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQL FKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKIS


    Database link: O60934
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • A549, Jurkat and PC-12 cell lysates; p95/NBS1 (aa 467-615) recombinant protein; p95/NBS1 (aa 467-615)-hIgGFc transfected HEK293 cell lysate; Hela cells; Human cervical cancer and Human rectum cancer tissues. WB: A431 cell lysate.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR150721-8 are from Tissue Culture Supernatant.

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    7E4A2
  • Isotype

    IgG2a
  • Research areas

    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • DNA Damage & Repair
    • Non Homol. End Joining
    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • DNA Damage & Repair
    • Homologous Recomb.
    • Cancer
    • Oncoproteins/suppressors
    • Tumor suppressors
    • Other

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG2a, kappa monoclonal [MG2a-53] - Isotype control (ab18415)
  • Positive Controls

    • Jurkat whole cell lysate (ab30128)
    • Jurkat whole cell lysate (ab7899)
    • A549 whole cell lysate (ab7910)
  • Recombinant Protein

    • Recombinant Human p95/NBS1 protein (ab158956)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab181729 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt
1/200 - 1/400.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 

IHC-P
1/200 - 1/1000.
WB
1/500 - 1/2000. Predicted molecular weight: 84 kDa.
ICC/IF
1/200 - 1/1000.
Notes
Flow Cyt
1/200 - 1/400.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 

IHC-P
1/200 - 1/1000.
WB
1/500 - 1/2000. Predicted molecular weight: 84 kDa.
ICC/IF
1/200 - 1/1000.

Target

  • Function

    Component of the MRE11-RAD50-NBN (MRN complex) which plays a critical role in the cellular response to DNA damage and the maintenance of chromosome integrity. The complex is involved in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity, cell cycle checkpoint control and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11A. RAD50 may be required to bind DNA ends and hold them in close proximity. NBN modulate the DNA damage signal sensing by recruiting PI3/PI4-kinase family members ATM, ATR, and probably DNA-PKcs to the DNA damage sites and activating their functions. It can also recruit MRE11 and RAD50 to the proximity of DSBs by an interaction with the histone H2AX. NBN also functions in telomere length maintenance by generating the 3' overhang which serves as a primer for telomerase dependent telomere elongation. NBN is a major player in the control of intra-S-phase checkpoint and there is some evidence that NBN is involved in G1 and G2 checkpoints. The roles of NBS1/MRN encompass DNA damage sensor, signal transducer, and effector, which enable cells to maintain DNA integrity and genomic stability. Forms a complex with RBBP8 to link DNA double-strand break sensing to resection. Enhances AKT1 phosphorylation possibly by association with the mTORC2 complex.
  • Tissue specificity

    Ubiquitous. Expressed at high levels in testis.
  • Involvement in disease

    Nijmegen breakage syndrome
    Breast cancer
    Aplastic anemia
    Defects in NBN might play a role in the pathogenesis of childhood acute lymphoblastic leukemia (ALL).
  • Sequence similarities

    Contains 1 BRCT domain.
    Contains 1 FHA domain.
  • Domain

    The FHA and BRCT domains are likely to have a crucial role for both binding to histone H2AFX and for relocalization of MRE11/RAD50 complex to the vicinity of DNA damage.
    The C-terminal domain contains a MRE11-binding site, and this interaction is required for the nuclear localization of the MRN complex.
    The EEXXXDDL motif at the C-terminus is required for the interaction with ATM and its recruitment to sites of DNA damage and promote the phosphorylation of ATM substrates, leading to the events of DNA damage response.
  • Post-translational
    modifications

    Phosphorylated by ATM in response of ionizing radiation, and such phosphorylation is responsible intra-S phase checkpoint control and telomere maintenance.
  • Cellular localization

    Nucleus. Nucleus, PML body. Chromosome, telomere. Localizes to discrete nuclear foci after treatment with genotoxic agents.
  • Target information above from: UniProt accession O60934 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 4683 Human
    • Entrez Gene: 100172091 Orangutan
    • Entrez Gene: 85482 Rat
    • Omim: 602667 Human
    • SwissProt: O60934 Human
    • SwissProt: Q5RCV3 Orangutan
    • SwissProt: Q9JIL9 Rat
    • Unigene: 492208 Human
    • Unigene: 25214 Rat
    see all
  • Alternative names

    • AT V1 antibody
    • AT V2 antibody
    • ATV antibody
    • Cell cycle regulatory protein p95 antibody
    • FLJ10155 antibody
    • MGC87362 antibody
    • Nbn antibody
    • NBN_HUMAN antibody
    • NBS 1 antibody
    • NBS antibody
    • NBS1 antibody
    • Nibrin antibody
    • Nijmegen breakage syndrome 1 (nibrin) antibody
    • Nijmegen breakage syndrome antibody
    • Nijmegen breakage syndrome protein 1 antibody
    • p95 antibody
    • p95 protein of the MRE11/RAD50 complex antibody
    see all

Images

  • Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
    Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
    All lanes : Anti-p95/NBS1 antibody [7E4A2] (ab181729) at 1/500 dilution

    Lane 1 : Wild-type A431 cell lysate
    Lane 2 : NBN knockout A431 cell lysate

    Performed under reducing conditions.

    Predicted band size: 84 kDa
    Observed band size: 95 kDa why is the actual band size different from the predicted?



    False colour image of Western blot: Anti-p95/NBS1 antibody [7E4A2] staining at 1/500 dilution, shown in green; Rabbit Anti-GAPDH antibody [EPR16891] (ab181602) loading control staining at 1/20000 dilution, shown in red. In Western blot, ab181729 was shown to bind specifically to p95/NBS1. A band was observed at 95 kDa in wild-type A431 cell lysates with no signal observed at this size in NBN knockout cell line ab269506 (knockout cell lysate ab269668). To generate this image, wild-type and NBN knockout A431 cell lysates were analysed. First, samples were run on an SDS-PAGE gel then transferred onto a nitrocellulose membrane. Membranes were blocked in 3 % milk in TBS-0.1 % Tween® 20 (TBS-T) before incubation with primary antibodies overnight at 4°C. Blots were washed four times in TBS-T, incubated with secondary antibodies for 1 h at room temperature, washed again four times then imaged.Secondary antibodies used were Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed (ab216772) and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed (ab216777) at 1/20000 dilution.

  • Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
    Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
    All lanes : Anti-p95/NBS1 antibody [7E4A2] (ab181729) at 1/500 dilution

    Lane 1 : A549 cell lysate
    Lane 2 : Jurkat cell lysate
    Lane 3 : PC-12 cell lysate

    Predicted band size: 84 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
    Immunocytochemistry/ Immunofluorescence - Anti-p95/NBS1 antibody [7E4A2] (ab181729)

    Immunofluorescent analysis of HeLa cells labeling p95/NBS1 with ab181729 at 1/200 (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

  • Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
    Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
    All lanes : Anti-p95/NBS1 antibody [7E4A2] (ab181729) at 1/500 dilution

    Lane 1 : non-transfected HEK293 cell lysate
    Lane 2 : p95/NBS1 (aa 467-615)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 84 kDa

  • Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
    Western blot - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
    Anti-p95/NBS1 antibody [7E4A2] (ab181729) at 1/500 dilution + p95/NBS1 (aa 467-615) human recombinant protein

    Predicted band size: 84 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p95/NBS1 antibody [7E4A2] (ab181729)

    Immunohistochemical analysis of paraffin embedded Human rectum cancer tissue labeling p95/NBS1 with ab181729 at 1/200 with DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p95/NBS1 antibody [7E4A2] (ab181729)

    Immunohistochemical analysis of paraffin embedded Human cervical cancer tissue labeling p95/NBS1 with ab181729 at 1/200 with DAB staining.

  • Flow Cytometry - Anti-p95/NBS1 antibody [7E4A2] (ab181729)
    Flow Cytometry - Anti-p95/NBS1 antibody [7E4A2] (ab181729)

    Flow Cytometrical analysis of HeLa cells labeling p95/NBS1 with ab181729 at 1/200 (green) compared to a negative control antibody (red).

Protocols

  • Flow cytometry protocols
  • Immunohistochemistry protocols
  • Immunocytochemistry & immunofluorescence protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (1)

Publishing research using ab181729? Please let us know so that we can cite the reference in this datasheet.

ab181729 has been referenced in 1 publication.

  • Tang D  et al. MYC/NBS1-Mediated DNA Damage Response is Involved in the Inhibitory Effect of Hydroxysafflor Yellow A on Glioma Cells. Drug Des Devel Ther 15:1749-1763 (2021). PubMed: 33953544

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab181729.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.