Overview

  • Product name

  • Description

    Rabbit polyclonal to PABPC1L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human PABPC1L aa 228-277. The exact sequence is proprietary.
    Sequence:

    GHSRCFGFVNFEKHEEAQKAVVHMNGKEVSGRLLYAGRAQKRVERQNELK


    Database link: Q4VXU2

Properties

Applications

Our Abpromise guarantee covers the use of ab186533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 68 kDa.

Target

Images

  • Western blot analysis of Jurkat whole cell lysate labelling PABPC1L with ab186516 at 1.0µg/ml.

References

This product has been referenced in:

  • Dong H  et al. Activation of LncRNA TINCR by H3K27 acetylation promotes Trastuzumab resistance and epithelial-mesenchymal transition by targeting MicroRNA-125b in breast Cancer. Mol Cancer 18:3 (2019). Read more (PubMed: 30621694) »
  • Dong H  et al. Long non-coding RNA SNHG14 induces trastuzumab resistance of breast cancer via regulating PABPC1 expression through H3K27 acetylation. J Cell Mol Med 22:4935-4947 (2018). Read more (PubMed: 30063126) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up