Overview

  • Product name

  • Description

    Rabbit polyclonal to PABPC1L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human PABPC1L aa 514-612. Expressed in E.coli. N-terminal tag.
    Sequence:

    STYRVQEPAVHIPGQEPLTASMLAAAPLHEQKQMIGERLYPLIHDVHTQL AGKITGMLLEIDNSELLLMLESPESLHAKIDEAVAVLQAHQAMEQPKAY


    Database link: Q4VXU2

  • Positive control

    • IHC-P: Human liver tissue. WB: Rat liver lysate; Recombinant human PABPC1L protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233280 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 63 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for PABPC1L using ab233280 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PABPC1L antibody (ab233280) at 2 µg/ml + Rat liver lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 63 kDa

  • Anti-PABPC1L antibody (ab233280) at 2 µg/ml + Recombinant human PABPC1L protein

    Predicted band size: 63 kDa

References

This product has been referenced in:

  • Wu YQ  et al. PABPC1L depletion inhibits proliferation and migration via blockage of AKT pathway in human colorectal cancer cells. Oncol Lett 17:3439-3445 (2019). Read more (PubMed: 30867782) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233280.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up