Overview

  • Product name

  • Description

    Rabbit polyclonal to PABPC5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla, Orangutan, Lar gibbon
  • Immunogen

    Recombinant fragment corresponding to Human PABPC5 aa 5-120.
    Sequence:

    EPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPV TRSPLGYGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSG VGNIFIKNLDKSIDNR


    Database link: Q96DU9

  • Positive control

    • WB: PABPC5 overexpression HEK-293T lysate. IHC-P: Human cerebral cortex tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 43 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    PABPC5 (polyadenylate-binding protein 5) binds the polyadenylate tail of mRNA and is thought to be involved in cytoplasmic regulatory processes of mRNA metabolism. In vivo, it may also bind to cytoplasmic RNA sequences other than polyadenylate.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • PABP5 antibody
    • Poly(A) binding protein 5 antibody
    • Poly(A) binding protein cytoplasmic 5 antibody
    • Polyadenylate binding protein 5 antibody

Images

  • Paraffin-embedded human cerebral cortex tissue stained for PABPC5 using ab224208 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-PABPC5 antibody (ab224208) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with a large T antigen) cell lysate
    Lane 2 : PABPC5 overexpression HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) lysate

    Developed using the ECL technique.

    Predicted band size: 43 kDa

References

ab224208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up