Overview

  • Product name

    Anti-PAC-3 antibody
  • Description

    Rabbit polyclonal to PAC-3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig
  • Immunogen

    Synthetic peptide corresponding to Human PAC-3 aa 66-115 (C terminal).
    Sequence:

    VLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREV


    Database link: NP_115678

  • Positive control

    • HT1080 cell lysate.
  • General notes

    Previously labelled as PSMG3. 

Properties

Applications

Our Abpromise guarantee covers the use of ab115962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 13 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Chaperone protein which promotes assembly of the 20S proteasome. May cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.
  • Sequence similarities

    Belongs to the PSMG3 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • C7orf48 antibody
    • hPAC3 antibody
    • MGC10911 antibody
    • PAC 3 antibody
    • PAC-3 antibody
    • PAC3 antibody
    • Proteasome (prosome macropain) assembly chaperone 3 antibody
    • Proteasome assembly chaperone 3 antibody
    • PSMG 3 antibody
    • PSMG3 antibody
    • PSMG3_HUMAN antibody
    see all

Images

  • Anti-PAC-3 antibody (ab115962) at 1 µg/ml + HT1080 cell lysate at 10 µg

    Predicted band size: 13 kDa



    Gel concentration: 10-20%

References

ab115962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up