Overview

  • Product name

  • Description

    Rabbit polyclonal to PACAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Synthetic peptide within Human PACAP aa 132-169 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK


    Database link: P18509

  • Positive control

    • IHC-P: Human colon carcinoma and rat brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab216589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity (By similarity). Isoform 2 may be involved in regulation of apoptosis. Helps to diversify peripheral B-cell functions by regulating Ca(2+) stores, antibody secretion and integrin activation.
    Acts as a hormone-regulated adipokine/proinflammatory cytokine that is implicated in causing chronic inflammation, affecting cellular expansion and blunting insulin response in adipocytes. May have a role in the onset of insulin resistance.
  • Tissue specificity

    Widely expressed with highest levels in adult brain, small intestine and lymphoid tissues such as thymus and spleen. Expression is frequently lower in intestinal-type gastric cancer. In obese patients, more abundant in omental than in subcutaneous fat.
  • Sequence similarities

    Belongs to the MZB1 family.
  • Post-translational
    modifications

    Forms an interchain disulfide bond with IgM monomers.
  • Cellular localization

    Endoplasmic reticulum lumen. Secreted and Cytoplasm. Diffuse granular localization in the cytoplasm surrounding the nucleus (PubMed:11350957).
  • Information by UniProt
  • Database links

  • Alternative names

    • MZB1 antibody
    • Caspase 2 binding protein antibody
    • FLJ32987 antibody
    • HSPC190 antibody
    • Marginal zone B and B1 cell specific protein antibody
    • Marginal zone B- and B1-cell-specific protein antibody
    • MEDA 7 antibody
    • MEDA-7 antibody
    • Mesenteric estrogen dependent adipose 7 antibody
    • Mesenteric estrogen-dependent adipose 7 antibody
    • Mesenteric oestrogen dependent adipose gene 7 antibody
    • MGC29506 antibody
    • Mzb1 antibody
    • MZB1_HUMAN antibody
    • PACAP antibody
    • pERp1 antibody
    • Plasma cell-induced ER protein 1 antibody
    • Plasma cell-induced resident endoplasmic reticulum protein antibody
    • Plasma cell-induced resident ER protein antibody
    • Proapoptotic caspase adapter protein antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human colon carcinoma tissue, labeling PACAP using ab216589 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat brain tissue, labeling PACAP using ab216589 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab216589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up