Anti-PACAP antibody (ab223166)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-PACAP antibody
See all PACAP primary antibodies -
Description
Rabbit polyclonal to PACAP -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PACAP aa 28-94.
Sequence:TATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSG GRRELSELVYTDVLDRS
Database link: Q8WU39 -
Positive control
- WB: Human tonsil lysate. IHC-P: Human tonsil tissue.
-
General notes
This product was previously labelled as Proapoptotic Caspase Adaptor Protein
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab223166 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/100 - 1/250. Predicted molecular weight: 21 kDa. | |
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity (By similarity). Isoform 2 may be involved in regulation of apoptosis. Helps to diversify peripheral B-cell functions by regulating Ca(2+) stores, antibody secretion and integrin activation.
Acts as a hormone-regulated adipokine/proinflammatory cytokine that is implicated in causing chronic inflammation, affecting cellular expansion and blunting insulin response in adipocytes. May have a role in the onset of insulin resistance. -
Tissue specificity
Widely expressed with highest levels in adult brain, small intestine and lymphoid tissues such as thymus and spleen. Expression is frequently lower in intestinal-type gastric cancer. In obese patients, more abundant in omental than in subcutaneous fat. -
Sequence similarities
Belongs to the MZB1 family. -
Post-translational
modificationsForms an interchain disulfide bond with IgM monomers. -
Cellular localization
Endoplasmic reticulum lumen. Secreted and Cytoplasm. Diffuse granular localization in the cytoplasm surrounding the nucleus (PubMed:11350957). - Information by UniProt
-
Database links
- Entrez Gene: 51237 Human
- Omim: 609447 Human
- SwissProt: Q8WU39 Human
- Unigene: 409563 Human
-
Alternative names
- MZB1 antibody
- Caspase 2 binding protein antibody
- FLJ32987 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PACAP antibody (ab223166)Paraffin-embedded human tonsil tissue stained for PACAP with ab223166 at 1/500 dilution in immunohistochemical analysis.
-
Western blot - Anti-PACAP antibody (ab223166)All lanes : Anti-PACAP antibody (ab223166) at 1/100 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
Lane 3 : Human plasma
Lane 4 : Human liver lysate
Lane 5 : Human tonsil lysate
Predicted band size: 21 kDa
Datasheets and documents
References
ab223166 has not yet been referenced specifically in any publications.
