Overview

  • Product name

  • Description

    Rabbit polyclonal to PACS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PACS1 aa 150-400.
    Sequence:

    SKRILRSNEIVLPASGLVETELQLTFSLQYPHFLKRDANKLQIMLQRRKR YKNRTILGYKTLAVGLINMAEVMQHPNEGALVLGLHSNVKDVSVPVAEIK IYSLSSQPIDHEGIKSKLSDRSPDIDNYSEEEEESFSSEQEGSDDPLHGQ DLFYEDEDLRKVKKTRRKLTSTSAITRQPNIKQKFVALLKRFKVSDEVGF GLEHVSREQIREVEEDLDELYDSLEMYNPSDSGPEMEETESILSTPKPKL K


    Database link: Q6VY07

  • Positive control

    • Raji lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab208171 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 105 kDa.

Target

  • Function

    Coat protein that is involved in the localization of trans-Golgi network (TGN) membrane proteins that contain acidic cluster sorting motifs. Controls the endosome-to-Golgi trafficking of furin and mannose-6-phosphate receptor by connecting the acidic-cluster-containing cytoplasmic domain of these molecules with the adapter-protein complex-1 (AP-1) of endosomal clathrin-coated membrane pits. Involved in HIV-1 nef-mediated removal of MHC-I from the cell surface to the TGN.
  • Involvement in disease

    Mental retardation, autosomal dominant 17
  • Sequence similarities

    Belongs to the PACS family.
  • Cellular localization

    Golgi apparatus, trans-Golgi network. Localizes in the perinuclear region, probably the TGN.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytosolic sorting protein PACS1 antibody
    • PACS 1 antibody
    • PACS-1 antibody
    • Pacs1 antibody
    • PACS1_HUMAN antibody
    • Phosphofurin acidic cluster sorting protein 1 antibody
    see all

Images

  • Anti-PACS1 antibody (ab208171) at 1 µg/ml + Raji lysate

    Predicted band size: 105 kDa

References

ab208171 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Mouse Tissue lysate - whole (brain)
Gel Running Conditions
Reduced Denaturing
Loading amount
20 µg
Specification
brain
Blocking step
Milk as blocking agent for 45 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Jun 07 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up