Overview

  • Product name

  • Description

    Rabbit polyclonal to PACS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PACS1 aa 427-524.
    Sequence:

    DTTSPMELAALEKIKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVP EKVKTPMKSSKTDLQGSASPSKVEGVHTPRQKRSTPLKERQLSKPLSE


    Database link: Q6VY07

  • Positive control

    • IHC-P: Human cerebral cortex, lymph node and testis tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab243703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Coat protein that is involved in the localization of trans-Golgi network (TGN) membrane proteins that contain acidic cluster sorting motifs. Controls the endosome-to-Golgi trafficking of furin and mannose-6-phosphate receptor by connecting the acidic-cluster-containing cytoplasmic domain of these molecules with the adapter-protein complex-1 (AP-1) of endosomal clathrin-coated membrane pits. Involved in HIV-1 nef-mediated removal of MHC-I from the cell surface to the TGN.
  • Involvement in disease

    Mental retardation, autosomal dominant 17
  • Sequence similarities

    Belongs to the PACS family.
  • Cellular localization

    Golgi apparatus, trans-Golgi network. Localizes in the perinuclear region, probably the TGN.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytosolic sorting protein PACS1 antibody
    • PACS 1 antibody
    • PACS-1 antibody
    • Pacs1 antibody
    • PACS1_HUMAN antibody
    • Phosphofurin acidic cluster sorting protein 1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells labeling PACS1 (Green) using ab243703 at 4 µg/mL in ICC/IF analysis.

  • Formalin-fixed, paraffin-embedded human testis tissue stained for PACS1 using ab243703 at 1/200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human lymph node tissue stained for PACS1 using ab243703 at 1/200 dilution in immunohistochemical analysis.

  • Negative control:

    Formalin-fixed, paraffin-embedded human liver tissue stained for PACS1 using ab243703 at 1/200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human cerebral cortex tissue stained for PACS1 using ab243703 at 1/200 dilution in immunohistochemical analysis.

References

ab243703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up