Overview

  • Product name

  • Description

    Rabbit polyclonal to PACSIN3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PACSIN3 aa 1-300.
    Sequence:

    MAPEEDAGGEALGGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIE KAYAQQLADWARKWRGTVEKGPQYGTLEKAWHAFFTAAERLSALHLEVRE KLQGQDSERVRAWQRGAFHRPVLGGFRESRAAEDGFRKAQKPWLKRLKEV EASKKSYHAARKDEKTAQTRESHAKADSAVSQEQLRKLQERVERCAKEAE KTKAQYEQTLAELHRYTPRYMEDMEQAFETCQAAERQRLLFFKDMLLTLH QHLDLSSSEKFHELHRDLHQGIEAASDEEDLRWWRSTHGPGMAMNWPQFE


    Database link: Q9UKS6

  • Positive control

    • WB: Rat liver tissue lysate. IHC-P: Human adrenal gland and breast cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235095 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Function

    May play a role in vesicle formation and transport.
  • Tissue specificity

    Expressed in heart and skeletal muscle, lung, kidney, adrenal gland and placenta.
  • Sequence similarities

    Belongs to the PACSIN family.
    Contains 1 FCH domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    Phosphorylated by casein kinase 2 (CK2) and protein kinase C (PKC).
  • Cellular localization

    Cytoplasm. Cell membrane. Detected at the inner aspect of the plasma membrane in cells or myotubes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Endophilin 1 antibody
    • Endophilin I antibody
    • FLJ17861 antibody
    • OTTHUMP00000234262 antibody
    • OTTHUMP00000234263 antibody
    • OTTHUMP00000234264 antibody
    • PACN3_HUMAN antibody
    • Pacsin3 antibody
    • Protein kinase C and casein kinase substrate in neurons 3 antibody
    • Protein kinase C and casein kinase substrate in neurons protein 3 antibody
    • SDPIII antibody
    • SH3 domain containing protein 6511 antibody
    • SH3 domain-containing protein 6511 antibody
    • syndapin III antibody
    see all

Images

  • Anti-PACSIN3 antibody (ab235095) at 1/500 dilution + Rat liver tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human breast cancer tissue stained for PACSIN3 using ab235095 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for PACSIN3 using ab235095 at 1/100 dilution in immunohistochemical analysis.

References

ab235095 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (intestine)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Dako retrieval solution (pH6)
Permeabilization
No
Specification
intestine
Blocking step
Agilent Protein Block, Serum-Free, Liquid form, 0.25% casein as blocking agent for 10 minute(s) · Concentration: 0.25% · Temperature: 22°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Dec 22 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up