Overview

  • Product name

    Anti-PACT (PKR activating protein) / PRKRA antibody
    See all PACT (PKR activating protein) / PRKRA primary antibodies
  • Description

    Rabbit polyclonal to PACT (PKR activating protein) / PRKRA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human PACT (PKR activating protein)/ PRKRA aa 1-313.
    Sequence:

    MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP VYECERSDVQIHVPTFTFRVTVGDITCTGEGTSKKLAKHRAAEAAINILK ANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQE GGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENH ISLTNVVGHSLGCTWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAK EQGFNITYLDIDELSANGQYQCLAELSTSPITVCHGSGISCGNAQSDAAH NALQYLKIIAERK


    Database link: O75569

  • Positive control

    • IHC-P: Human prostate cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab238734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
ICC/IF 1/50 - 1/500.

Target

  • Function

    Activates EIF2AK2/PKR in the absence of double stranded RNA (dsRNA), leading to phosphorylation of EIF2S1/EFI2-alpha and inhibition of translation and induction of apoptosis. Required for siRNA production by DICER1 and for subsequent siRNA-mediated post-transcriptional gene silencing. Does not seem to be required for processing of pre-miRNA to miRNA by DICER1.
  • Involvement in disease

    Defects in PRKRA are the cause of dystonia type 16 (DYT16) [MIM:612067]. DYT16 is an early-onset dystonia-parkinsonism disorder. Dystonia is defined by the presence of sustained involuntary muscle contraction, often leading to abnormal postures. DYT16 patients have progressive, generalized dystonia with axial muscle involvement, oro-mandibular (sardonic smile) and laryngeal dystonia and, in some cases, parkinsonian features.
  • Sequence similarities

    Belongs to the PRKRA family.
    Contains 3 DRBM (double-stranded RNA-binding) domains.
  • Domain

    Self-association may occur via interactions between DRBM domains as follows: DRBM 1/DRBM 1, DRBM 1/DRBM 2, DRBM 2/DRBM 2 or DRBM 3/DRBM3.
  • Post-translational
    modifications

    Phosphorylated at Ser-246 in unstressed cells and at Ser-287 in stressed cells. Phosphorylation at Ser-246 appears to be a prerequisite for subsequent phosphorylation at Ser-287. Phosphorylation at Ser-246 and Ser-287 are necessary for activation of EIF2AK2/PKR under conditions of stress.
  • Cellular localization

    Cytoplasm > perinuclear region.
  • Information by UniProt
  • Database links

  • Alternative names

    • DYT16 antibody
    • HSD14 antibody
    • Interferon inducible double stranded RNA dependent protein kinase activator A antibody
    • interferon-inducible double stranded RNA-dependent activator antibody
    • Interferon-inducible double stranded RNA-dependent protein kinase activator A antibody
    • PACT antibody
    • PKR associated protein X antibody
    • PKR associating protein X antibody
    • PKR-associated protein X antibody
    • PKR-associating protein X antibody
    • PRKRA antibody
    • PRKRA_HUMAN antibody
    • Protein activator of the interferon induced protein kinase antibody
    • Protein activator of the interferon-induced protein kinase antibody
    • Protein kinase antibody
    • Protein kinase interferon inducible double stranded RNA dependent activator antibody
    • RAX antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for PACT (PKR activating protein) / PRKRA using ab238734 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for PACT (PKR activating protein) / PRKRA (green) using ab238734 at 1/266 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI (Blue).

    The cells were fixed in 4% formaldehyde, permeabilized tissue using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C.

     

References

ab238734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up