Overview

  • Product name
    Anti-PADI1 / PAD1 antibody
    See all PADI1 / PAD1 primary antibodies
  • Description
    Rabbit polyclonal to PADI1 / PAD1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PADI1/ PAD1 aa 495-550.
    Sequence:

    PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQ KCIDWN


    Database link: Q9ULC6

  • Positive control
    • IHC-P: Human esophagus tissue. ICC/IF: HaCaT cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab251967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Catalyzes the deimination of arginine residues of proteins.
  • Tissue specificity
    Epidermis, prostate, testis, placenta, spleen and thymus.
  • Sequence similarities
    Belongs to the protein arginine deiminase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • HPAD10 antibody
    • Padi1 antibody
    • PADI1_HUMAN antibody
    • PDI antibody
    • PDI1 antibody
    • Peptidylarginine deiminase I antibody
    • protein arginine deiminase type I antibody
    • Protein-arginine deiminase type I antibody
    • Protein-arginine deiminase type-1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HaCaT cells stained for PADI1 / PAD1 (green) using ab251967 at 4 µg/ml in ICC/IF.
  • Paraffin-embedded human esophagus tissue stained for PADI1 / PAD1 using ab251967 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human colon tissue stained for PADI1 / PAD1 using ab251967 at 1/500 dilution in immunohistochemical analysis. Low expression as expected.

References

ab251967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab251967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up