Overview

  • Product name
    Anti-PADI2 / PAD2 antibody
    See all PADI2 / PAD2 primary antibodies
  • Description
    Rabbit polyclonal to PADI2 / PAD2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Rat, Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human PADI2/ PAD2 aa 1-300. N-terminal His-tag and GST-tag. Expressed in E. coli.
    Sequence:

    MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWV EVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDE EGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAI LLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEI VLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLF FVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT


    Database link: Q9Y2J8

  • Positive control
    • WB: Recombinant human PADI2 / PAD2 protein; rat and porcine cerebrum tissue lysate. IHC-P: Human brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/400. Predicted molecular weight: 76 kDa.
IHC-P 1/10 - 1/100.

Target

  • Function
    Catalyzes the deimination of arginine residues of proteins.
  • Sequence similarities
    Belongs to the protein arginine deiminase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • KIAA0994 antibody
    • OTTHUMP00000044625 antibody
    • PAD 2 antibody
    • PAD H19 antibody
    • PAD-H19 antibody
    • PAD2 antibody
    • PADI 2 antibody
    • Padi2 antibody
    • PADI2 protein antibody
    • PADI2_HUMAN antibody
    • PDI 2 antibody
    • PDI2 antibody
    • Peptidlyarginine deiminase type II antibody
    • Peptidyl arginine deiminase II antibody
    • Peptidyl arginine deiminase type II antibody
    • Peptidylarginine deiminase II antibody
    • Protein arginine deiminase antibody
    • Protein arginine deiminase type 2 antibody
    • Protein arginine deiminase type II antibody
    • Protein-arginine deiminase type II antibody
    • Protein-arginine deiminase type-2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human brain tissue stained for PADI2 / PAD2 using ab231911 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PADI2 / PAD2 antibody (ab231911) at 3 µg/ml + Rat cerebrum tissue lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 76 kDa

  • Anti-PADI2 / PAD2 antibody (ab231911) at 3 µg/ml + Porcine cerebrum tissue lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 76 kDa

  • Anti-PADI2 / PAD2 antibody (ab231911) at 3 µg/ml + Recombinant human PADI2 / PAD2 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 76 kDa

References

ab231911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up