Overview

  • Product name

  • Description

    Rabbit polyclonal to PAFAH1B2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human PAFAH1B2 aa 2-229.
    Sequence:

    SQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQ LMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVW VGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQ KNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGG YAKICKPLHELIMQLLEETPEEKQTTIA


    Database link: P68402-1

  • Positive control

    • IHC-P: Human small intestine, endometrial cancer, colon cancer and glioma tissues. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab238828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Inactivates PAF by removing the acetyl group at the sn-2 position. This is a catalytic subunit.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Intracellular platelet activating factor acetylhydrolase alpha 2 subunit antibody
    • PA1B2_HUMAN antibody
    • PAF acetylhydrolase 30 kDa subunit antibody
    • PAF AH 30 kDa subunit antibody
    • PAF AH beta subunit antibody
    • PAF AH subunit beta antibody
    • PAF-AH 30 kDa subunit antibody
    • PAF-AH subunit beta antibody
    • PAFAH 30 kDa subunit antibody
    • PAFAH beta subunit antibody
    • PAFAH subunit beta antibody
    • Pafah1b2 antibody
    • PAFAH1B2 protein antibody
    • PAFAHB antibody
    • Platelet activating factor acetylhydrolase 1b catalytic subunit 2 antibody
    • Platelet activating factor acetylhydrolase IB beta subunit antibody
    • Platelet activating factor acetylhydrolase IB subunit beta antibody
    • Platelet activating factor acetylhydrolase isoform Ib beta subunit antibody
    • Platelet activating factor acetylhydrolase isoform Ib subunit 2 antibody
    • Platelet-activating factor acetylhydrolase IB subunit beta antibody
    see all

Images

  • MCF7 (Human breast adenocarcinoma cell line) cells stained for PAFAH1B2 (green) using ab238828 at 1/100 dilution in ICC/IF, followed by Alexa Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human small intestine tissue stained for PAFAH1B2 using ab238828 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrial cancer tissue stained for PAFAH1B2 using ab238828 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for PAFAH1B2 using ab238828 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma tissue stained for PAFAH1B2 using ab238828 at 1/100 dilution in immunohistochemical analysis.

References

ab238828 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up