Overview

  • Product name

  • Description

    Rabbit polyclonal to PAG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PAG aa 126-204.
    Sequence:

    KCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENM VEDCLYETVKEIKEVAAAAHLEKGHSGKA


    Database link: Q9NWQ8

  • Positive control

    • WB: RT-4 and U-251 MG cell lysate. ICC/IF: RT-4 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221564 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 47 kDa.

Target

  • Function

    Negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Promotes CSK activation and recruitment to lipid rafts, which results in LCK inhibition. Inhibits immunological synapse formation by preventing dynamic arrangement of lipid raft proteins. May be involved in cell adhesion signaling.
  • Tissue specificity

    Ubiquitously expressed. Present in germinal center B-cells, plasma cells, T-cells, monocytes and platelets (at protein level).
  • Post-translational
    modifications

    Palmitoylated.
    Phosphorylated by FYN on Tyr-317 in resting T-cells; which promotes interaction with CSK. Dephosphorylated by PTPRC/CD45 upon TCR activation; which leads to CSK dissociation. May also be dephosphorylated by PTPN11. Hyperphosphorylated in mast cells upon FCER1 activation.
  • Cellular localization

    Cell membrane. Present in lipid rafts.
  • Information by UniProt
  • Database links

  • Alternative names

    • CBP antibody
    • Csk binding protein antibody
    • Csk-binding protein antibody
    • FLJ37858 antibody
    • MGC138364 antibody
    • PAG 1 antibody
    • PAG antibody
    • PAG1 antibody
    • PAG1_HUMAN antibody
    • Phosphoprotein associated with glycosphingolipid enriched microdomains 1 antibody
    • Phosphoprotein associated with glycosphingolipid enriched microdomains antibody
    • Phosphoprotein associated with glycosphingolipid microdomains 1 antibody
    • Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 antibody
    • Protein Associated with Glycosphingolipid Enriched Microdomains antibody
    • Transmembrane adapter protein PAG antibody
    • Transmembrane phosphoprotein Cbp antibody
    see all

Images

  • RT-4 cells stained for PAG (green) using ab221564 (4 µg/ml) in ICC/IF.

  • All lanes : Anti-PAG antibody (ab221564) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 47 kDa

References

ab221564 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221564.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up