Overview

  • Product name

    Anti-PAGE2 antibody
  • Description

    Rabbit polyclonal to PAGE2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Fusion protein corresponding to Human PAGE2 aa 1-111. (BC054022. The identity of the protein fusion partner is GST).
    Sequence:

    MSELLRARSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIA PSGEIENQAVPAFQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDL TKVLEAGDAQP


    Database link: Q7Z2X7

  • Positive control

    • Mouse brain and kidney tissue lysates; Human brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab198208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 12 kDa.
IHC-P 1/25 - 1/100.

Target

  • Database links

  • Alternative names

    • CT16.4 antibody
    • G antigen family C 2 antibody
    • G antigen family E 2 antibody
    • G antigen family E member 2 antibody
    • GAGEC2 antibody
    • GAGEE2 antibody
    • P antigen family member 2 (prostate associated) antibody
    • PAGE 2 antibody
    • Prostate associated gene 2 antibody
    • Prostate associated gene 2 protein antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human brain tissue labeling PAGE2 with ab198208 at 1/20 dilution.

  • All lanes : Anti-PAGE2 antibody (ab198208) at 1/400 dilution

    Lane 1 : Mouse brain tissue lysate
    Lane 2 : Mouse kidney tissue lysate

    Lysates/proteins at 40 µg per lane.

    Predicted band size: 12 kDa


    Exposure time: 1 minute


    10% SDS-PAGE.

References

ab198208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up