Overview

  • Product name

  • Description

    Rabbit polyclonal to PAGE4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human PAGE4 aa 1-102.
    Sequence:

    DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPT DNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPP NPKHAKTKEAGDGQP


    Database link: O60829

  • Positive control

    • IHC-P: Human placenta tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224454 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    PAGE4 belongs to the GAGE family of genes which are expressed in a variety of tumors and in some fetal and reproductive tissues. PAGE4 is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer.
  • Database links

  • Alternative names

    • FLJ35184 antibody
    • G antigen family C 1 antibody
    • G antigen family C member 1 antibody
    • GAGE 9 antibody
    • GAGE9 antibody
    • GAGEC1 antibody
    • JM 27 antibody
    • JM27 antibody
    • P antigen family member 4 (prostate associated) antibody
    • P antigen family member 4 antibody
    • PAGE 1 antibody
    • PAGE 4 antibody
    • PAGE1 antibody
    • Prostate associated gene 4 protein antibody
    • Prostate associated gene protein 4 antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for PAGE4 using ab224454 at 1/500 dilution in immunohistochemical analysis.

References

ab224454 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224454.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up