Overview

  • Product name

  • Description

    Rabbit polyclonal to PAICS/PAIS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PAICS/PAIS aa 83-166.
    Sequence:

    ETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKD DANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMS


    Database link: P22234

  • Positive control

    • WB: RT4, U-251 MG, NIH/3T3 and NBT-II cell lysates. IHC-P: Human colon tissue.
  • General notes

     This product was previously labelled as PAICS

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 47,48 kDa.

Target

  • Pathway

    Purine metabolism; IMP biosynthesis via de novo pathway; 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide from 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate: step 1/2.
    Purine metabolism; IMP biosynthesis via de novo pathway; 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate from 5-amino-1-(5-phospho-D-ribosyl)imidazole (carboxylase route): step 1/1.
  • Sequence similarities

    In the N-terminal section; belongs to the SAICAR synthetase family.
    In the C-terminal section; belongs to the AIR carboxylase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADE2 antibody
    • ADE2H1 antibody
    • AIR carboxylase antibody
    • AIRC antibody
    • DKFZp781N1372 antibody
    • MGC1343 antibody
    • MGC5024 antibody
    • Multifunctional protein ADE2 antibody
    • Multifunctional protein ADE2H1 antibody
    • Paics antibody
    • PAIS antibody
    • Phosphoribosylaminoimidazole carboxylase antibody
    • Phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase antibody
    • PUR6_HUMAN antibody
    • SAICAR synthetase antibody
    see all

Images

  • Paraffin-embedded human colon tissue stained for PAICS/PAIS using ab224155 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-PAICS/PAIS antibody (ab224155) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 47,48 kDa

  • All lanes : Anti-PAICS/PAIS antibody (ab224155) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 47,48 kDa

References

ab224155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up