Overview

  • Product name

    Anti-PAIP2 antibody
  • Description

    Rabbit polyclonal to PAIP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Chicken, Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human PAIP2 aa 1-127.
    Sequence:

    MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEE LWEEEFIERCFQEMLEEEEEHEWFIPARDLPQTMDQIQDQFNDLVISDGS SLEDLVVKSNLNPNAKEFVPGVKYGNI


    Database link: Q9BPZ3

  • Positive control

    • WB: HeLa, Jurkat, SH-SY5Y and HEK-293 whole cell lysate; Mouse lung, liver, kidney and brain tissue lysate. IHC-P: Human lung tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 15 kDa.
ICC/IF 1/50 - 1/200.

Target

Images

  • Paraffin-embedded human lung tissue stained for PAIP2 using ab237803 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PAIP2 (green) using ab237803 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

  • All lanes : Anti-PAIP2 antibody (ab237803) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : SH-SY5Y (human neuroblastoma cell line from bone marrow) whole cell lysate
    Lane 4 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 5 : Mouse lung tissue lysate
    Lane 6 : Mouse liver tissue lysate
    Lane 7 : Mouse kidney tissue lysate
    Lane 8 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 15 kDa

References

ab237803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up