Overview

  • Product name
    Anti-Paladin antibody
  • Description
    Mouse polyclonal to Paladin
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human Paladin aa 1-856.
    Sequence:

    MGTTASTAQQTVSAGTPFEGLQGSGTMDSRHSVSIHSFQSTSLHNSKAKS IIPNKVAPVVITYNCKEEFQIHDELLKAHYTLGRLSDNTPEHYLVQGRYF LVRDVTEKMDVLGTVGSCGAPNFRQVQGGLTVFGMGQPSLLGFRRVLQKL QKDGHRECVIFCVREEPVLFLRADEDFVSYTPRDKQNLHENLQGLGPGVR VESLELAIRKEIHDFAQLSENTYHVYHNTEDLWGEPHAVAIHGEDDLHVT EEVYKRPLFLQPTYRYHRLPLPEQGSPLEAQLDAFVSVLRETPSLLQLRD AHGPPPALVFSCQMGVGRTNLGMVLGTLILLHRSGTTSQPEAAPTQAKPL PMEQFQVIQSFLRMVPQGRRMVEEVDRAITACAELHDLKEVVLENQKKLE GIRPESPAQGSGSRHSVWQRALWSLERYFYLILFNYYLHEQYPLAFALSF SRWLCAHPELYRLPVTLSSAGPVAPRDLIARGSLREDDLVSPDALSTVRE MDVANFRRVPRMPIYGTAQPSAKALGSILAYLTDAKRRLRKVVWVSLREE AVLECDGHTYSLRWPGPPVAPDQLETLEAQLKAHLSEPPPGKEGPLTYRF QTCLTMQEVFSQHRRACPGLTYHRIPMPDFCAPREEDFDQLLEALRAALS KDPGTGFVFSCLSGQGRTTTAMVVAVLAFWHIQGFPEVGEEELVSVPDAK FTKGEFQVVMKVVQLLPDGHRVKKEVDAALDTVSETMTPMHYHLREIIIC TYRQAKAAKEAQEMRRLQLRSLQYLERYVCLILFNAYLHLEKADSWQRPF STWMQEVASKAGIYEILNELGFPELESGEDQPFSRLRYRWQEQSCSLEPS APEDLL


    Database link: NP_055246

  • Positive control
    • Paladin transfected 293T cell lysate.
  • General notes

    Previously labelled as PALD. 

Properties

Applications

Our Abpromise guarantee covers the use of ab169051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 97 kDa.

Target

Images

  • All lanes : Anti-Paladin antibody (ab169051) at 1/500 dilution

    Lane 1 : Paladin transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 97 kDa

References

ab169051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up