Overview

  • Product name

  • Description

    Rabbit polyclonal to PALB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PALB2 aa 79-169.
    Sequence:

    YDKLHIKTHLDEETGEKTSITLDVGPESFNPGDGPGGLPIQRTDDTQEHF PHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSL


    Database link: Q86YC2

  • Positive control

    • A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Plays a critical role in homologous recombination repair (HRR) through its ability to recruit BRCA2 and RAD51 to DNA breaks. Serves as the molecular scaffold in the formation of the BRCA1-PALB2-BRCA2 complex which is essential for homologous recombination. Strongly stimulates the DNA strand-invasion activity of RAD51, stabilizes the nucleoprotein filament against a disruptive BRC3-BRC4 polypeptide and helps RAD51 to overcome the suppressive effect of replication protein A (RPA). Functionally cooperates with RAD51AP1 in promoting of D-loop formation by RAD51. Essential partner of BRCA2 that promotes the localization and stability of BRCA2. Also enables its recombinational repair and checkpoint functions of BRCA2. May act by promoting stable association of BRCA2 with nuclear structures, allowing BRCA2 to escape the effects of proteasome-mediated degradation. Binds DNA with high affinity for D loop, which comprises single-stranded, double-stranded and branched DNA structures.
  • Involvement in disease

    Note=Genetic variations in PALB2 are associated with breast cancer susceptibility.
    Defects in PALB2 are the cause of Fanconi anemia complementation group N (FANCN) [MIM:610832]. It is a disorder affecting all bone marrow elements and resulting in anemia, leukopenia and thrombopenia. It is associated with cardiac, renal and limb malformations, dermal pigmentary changes, and a predisposition to the development of malignancies. At the cellular level it is associated with hypersensitivity to DNA-damaging agents, chromosomal instability (increased chromosome breakage) and defective DNA repair.
    Defects in PALB2 are the cause of pancreatic cancer type 3 (PNCA3) [MIM:613348]. It is a malignant neoplasm of the pancreas. Tumors can arise from both the exocrine and endocrine portions of the pancreas, but 95% of them develop from the exocrine portion, including the ductal epithelium, acinar cells, connective tissue, and lymphatic tissue.
  • Sequence similarities

    Contains 7 WD repeats.
  • Domain

    Interaction with BRCA2 occurs through a hydrophobic pocket at the crossover between WD repeats 4 and 5.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Colocalizes with BRCA2 in nuclear foci.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4732427B05 antibody
    • BC066140 antibody
    • DKFZp667I166 antibody
    • DKFZp686E1054 antibody
    • FANCN antibody
    • FANCN GENE antibody
    • FLJ21816 antibody
    • OTTMUSP00000025884 antibody
    • PALB2 antibody
    • PALB2_HUMAN antibody
    • Partner and localizer of BRCA2 antibody
    • PNCA3 antibody
    • RGD1304759 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling PALB2 with ab220861 at 4 µg/ml (green).

References

ab220861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up