Overview

  • Product name

  • Description

    Rabbit polyclonal to Pallidin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human Pallidin aa 1-170.
    Sequence:

    MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE QLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLD INALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELER EQQREKEFEREKQLTARPAK


    Database link: Q9UL45

  • Positive control

    • WB: A431 and HEK-293T whole cell lysates. IHC-P: Human pancreatic cancer tissue. IP: HEK-293 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab230361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 20 kDa (predicted molecular weight: 20, 9 kDa).
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/2000.

Target

  • Function

    Involved in the development of lysosome-related organelles, such as melanosomes and platelet-dense granules. May play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process.
  • Tissue specificity

    Widely expressed.
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Cytoplasm. Endomembrane system. It can exist as a soluble protein as well as a peripheral membrane protein.
  • Information by UniProt
  • Database links

  • Alternative names

    • Bloc1s6 antibody
    • iogenesis of lysosome-related organelles complex 1 subunit 6 antibody
    • PA antibody
    • Pallid (mouse) homolog antibody
    • PALLID antibody
    • Pallid protein antibody
    • Pallid protein homolog antibody
    • Pallidin antibody
    • Pallidin homolog (mouse) antibody
    • PLDN antibody
    • PLDN_HUMAN antibody
    • Syntaxin 13 binding protein antibody
    • Syntaxin 13-interacting protein antibody
    see all

Images

  • All lanes : Anti-Pallidin antibody (ab230361) at 1/1000 dilution

    Lane 1 : A431 (human epidermoid carcinoma cell line) whole cell lysate
    Lane 2 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 20, 9 kDa
    Observed band size: 20 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human pancreatic cancer tissue stained for Pallidin using ab230361 at 1/100 dilution in immunohistochemical analysis.

  • Pallidin was immunoprecipitated from 500 µg HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate with 4 µg ab230361. 

    Lane 1: Rabbit monoclonal IgG (1 µg) IP in HEK-293 whole cell lysate.

    Lane 2: ab230361 IP in HEK-293 whole cell lysate.

    Lane 3: HEK-293 whole cell lysate 20 µg (Input).

    For western blotting, an HRP-conjugated anti-rabbit IgG, specific to the non-reduced form of IgG was used as the Secondary antibody at 1/50000 dilution.

References

ab230361 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230361.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up