Overview

  • Product name

    Anti-pan Cytokeratin antibody
    See all pan Cytokeratin primary antibodies
  • Description

    Rabbit polyclonal to pan Cytokeratin
  • Host species

    Rabbit
  • Specificity

    This antibody cocktail recognizes acidic (Type I or LMW) and basic (Type II or HMW) cytokeratins, which 67kDa (CK1); 64kDa (CK3); 59kDa (CK4); 58kDa (CK5); 56kDa (CK6); 52kDa (CK8); 56.5kDa (CK10); 50kDa (CK14); 50kDa (CK15); 48kDa (CK16); 40kDa (CK19).
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    This product was produced with the following immunogens:
    Recombinant full length protein within Human Cytokeratin aa 1-578. The exact sequence is proprietary. NCBI Accession No. 374454.
    Sequence:

    MSHQFSSQSAFSSMSRRVYSTSSSAGSGGGSPAVGSVCYARGRCGGGGYG IHGRGFGSRSLYNLGGSRSISINLMGRSTSGFCQGGGVGGFGGGRGFGVG STGAGGFGGGGFGGAGFGTSNFGLGGFGPYCPPGGIQEVTINQSLLEPLH LEVDPEIQRIKTQEREQIMVLNNKFASFIDKVRFLEQQNQVLQTKWELLQ QVNTSTGTNNLEPLLENYIGDLRRQVDLLSAEQMRQNAEVRSMQDVVEDY KSKYEDEINKRTGSENDFVVLKKDVDAAYVSKVDLESRVDTLTGEVNFLK YLFLTELSQVQTHISDTNVILSMDNNRSLDLDSIIDAVRTQYELIAQRSK DEAEALYQTKYQELQITAGRHGDDLKNSKMEIAELNRTVQRLQAEISNVK KQIEQMQSLISDAEERGEQALQDAWQKLQDLEEALQQSKEELARLLRDYQ AMLGVKLSLDVEIATYRQLLEGEESRMSGELQSHVSISVQNSQVSVNGGA GGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGRSGGGYGSGCGGGGGSYG GSGRSGRGSSRVQIIQTSTNTSHRRILE


    Database link: Q7Z794

    Recombinant full length protein corresponding to Human Cytokeratin aa 1-638. NCBI Accession No. 51350.
    Sequence: MNRQVCKKSFSGRSQGFSGRSAVVSGSSRMSCVARSGGAGGGACGFRSGA GSFGSRSLYNLGSNKSISISVAAGSSRAGGFGGGRSSCGFAGGYGGGFGG SYGGGFGGGRGVGSGFGGAGGFGGAGGFGGPGVFGGPGSFGGPGGFGPGG FPGGIQEVIVNQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDK VRFLEQQNKVLETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLG ERGNLEGELKSMQDLVEDFKKKYEDEINKRTAAENEFVGLKKDVDAAFMN KVELQAKVDSLTDEVSFLRTLYEMELSQMQSHASDTSVVLSMDNNRCLDL GSIIAEVRAQYEEIAQRSKSEAEALYQTKLGELQTTAGRHGDDLRNTKSE IMELNRMIQRLRAEIENVKKQNANLQTAIAEAEQRGEMALKDANAKLQDL QTALQKAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGEC QSAVCISVVSNVTSTSGSSGSSRGVFGGVSGSGSGGYKGGSSSSSSSGYG VSGGSGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGS SSGSIQTSGGSGYKSGGGGSTSIRFSQTTSSSQHSSTK
    Database link: Q01546

  • Positive control

    • IHC-P: Human skin tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.05% BSA, 99% PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.25 - 0.5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Cytokeratins, a group comprising at least 29 different proteins, are characteristic of epithelial and trichocytic cells. Cytokeratins 1, 4, 5, 6, and 8 are members of the type II neutral to basic subfamily. Monoclonal anti cytokeratins are specific markers of epithelial cell differentiation and have been widely used as tools in tumor identification and classification. Monoclonal Anti Pan Cytokeratin (mixture) is a broadly reactive reagent, which recognizes epitopes present in most human epithelial tissues. It facilitates typing of normal, metaplastic and neoplastic cells. Synergy between the various components results in staining amplification. This enables identification of cells, which would otherwise be stained only marginally. The mixture may aid in the discrimination of carcinomas and nonepithelial tumors such as sarcomas, lymphomas and neural tumors. It is also useful in detecting micrometastases in lymph nodes, bone marrow and other tissues and for determining the origin of poorly differentiated tumors. There are two types of cytokeratins the acidic type I cytokeratins and the basic or neutral type II cytokeratins. Cytokeratins are usually found in pairs comprising a type I cytokeratin and a type II cytokeratin. Usually the type II cytokeratins are 8kD larger than their type I counterparts.
  • Cellular localization

    Cytoplasmic
  • Database links

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human skin tissue, labeling Cytokeratin using ab217916 at 0.5 µg/mL.

References

ab217916 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up