Overview

  • Product name

    Anti-Pancreatic alpha amylase antibody
    See all Pancreatic alpha amylase primary antibodies
  • Description

    Sheep polyclonal to Pancreatic alpha amylase
  • Host species

    Sheep
  • Specificity

    This antibody recongizes native AMY2A
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Full length native protein (purified) corresponding to Human Pancreatic alpha amylase aa 16-511.
    Sequence:

    QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVA IYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVIN HMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIEN YNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASK HMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGN GRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHD NQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQN GNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNV VDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYC DVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL


    Database link: P04746

  • Positive control

    • Human pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab189341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 2.5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
WB Use at an assay dependent concentration. Predicted molecular weight: 58 kDa.

Target

  • Relevance

    Pancreatic amylase is a digestive enzyme secreted by the pancreas. It consists of a single polypeptide chain with a molecular weight of 54 kDa. Pancreatic amylase occurs in serum at a concentration of about 60µg/L, from a total amylase concentration in serum of about 120µg/L. Pancreatic amylase and salivary amylase are the products of separate genes and, although they share 98% amino acid sequence homology, they differ in molecular size, isoelectric point and antigenic properties. Measurement of amylase concentrations in serum is a diagnostic test for various pancreatic disorders (especially acute and relapsing pancreatitis).
  • Cellular localization

    Secreted protein; extracellular space.
  • Database links

  • Alternative names

    • 1 4 alpha D glucan glucanohydrolase antibody
    • 1,4 alpha D glucan glucanohydrolase 2B antibody
    • Alpha amylase 2B antibody
    • Alpha amylase antibody
    • alpha-amylase found in the pancreas antibody
    • AMY2 antibody
    • AMY2A antibody
    • AMY2B antibody
    • AMY3 antibody
    • Amylase alpha 2A antibody
    • Amylase alpha 2A pancreatic antibody
    • Amylase alpha 2B antibody
    • Amylase alpha 2B pancreatic antibody
    • Amylase pancreatic alpha 2A antibody
    • Amylase pancreatic alpha 2B antibody
    • Amylase, alpha 2A (pancreatic) antibody
    • Amylase, alpha 2B (pancreatic) antibody
    • Carcinoid alpha amylase antibody
    • carcinoid alpha-amylase antibody
    • Found in the pancreas antibody
    • Glycogenase antibody
    • HXA antibody
    • PA antibody
    • Pancreatic alpha amylase antibody
    • pancreatic alpha-amylase antibody
    • Pancreatic amylase 2A antibody
    • Pancreatic amylase alpha 2A antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human pancreas tissue, labeling AMY2A using ab189341 at 2.5 µg/ml.

References

ab189341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Pig Tissue sections (pancreas)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 10mm Sodium citrate PH 6
Permeabilization
No
Specification
pancreas
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Dec 06 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up