Overview

  • Product name

    Anti-Pancreatic alpha amylase antibody
    See all Pancreatic alpha amylase primary antibodies
  • Description

    Rabbit polyclonal to Pancreatic alpha amylase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Pancreatic alpha amylase aa 201-473. Expressed in E. coli.
    Sequence:

    IGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRPFIFQEVIDLG GEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVP TDRALVFVDNHDNQRGHGAGGASILTFWDARMYKMAVGFMLAHPYGFTRV MSSYRWARNFQNGKDVNDWIGPPNNNGVTKEVTINPDTTCGNDWVCEHRW RQIRNMVAFRNVVNGQPFANWWDNGSNQVAFSRGNRGFIVFNNDDWALSS TLQTGLPAGTYCDVISGDKVNGN


    Database link: G3V844

  • Positive control

    • IHC-P: Rat pancreas tissue. WB: Recombinant rat Pancreatic alpha amylase protein. Rat pancreas lysate and serum.

Properties

Applications

Our Abpromise guarantee covers the use of ab231119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Relevance

    Pancreatic amylase is a digestive enzyme secreted by the pancreas. It consists of a single polypeptide chain with a molecular weight of 54 kDa. Pancreatic amylase occurs in serum at a concentration of about 60µg/L, from a total amylase concentration in serum of about 120µg/L. Pancreatic amylase and salivary amylase are the products of separate genes and, although they share 98% amino acid sequence homology, they differ in molecular size, isoelectric point and antigenic properties. Measurement of amylase concentrations in serum is a diagnostic test for various pancreatic disorders (especially acute and relapsing pancreatitis).
  • Cellular localization

    Secreted protein; extracellular space.
  • Database links

  • Alternative names

    • 1 4 alpha D glucan glucanohydrolase antibody
    • 1,4 alpha D glucan glucanohydrolase 2B antibody
    • Alpha amylase 2B antibody
    • Alpha amylase antibody
    • alpha-amylase found in the pancreas antibody
    • AMY2 antibody
    • AMY2A antibody
    • AMY2B antibody
    • AMY3 antibody
    • Amylase alpha 2A antibody
    • Amylase alpha 2A pancreatic antibody
    • Amylase alpha 2B antibody
    • Amylase alpha 2B pancreatic antibody
    • Amylase pancreatic alpha 2A antibody
    • Amylase pancreatic alpha 2B antibody
    • Amylase, alpha 2A (pancreatic) antibody
    • Amylase, alpha 2B (pancreatic) antibody
    • Carcinoid alpha amylase antibody
    • carcinoid alpha-amylase antibody
    • Found in the pancreas antibody
    • Glycogenase antibody
    • HXA antibody
    • PA antibody
    • Pancreatic alpha amylase antibody
    • pancreatic alpha-amylase antibody
    • Pancreatic amylase 2A antibody
    • Pancreatic amylase alpha 2A antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat pancreas tissue stained for Pancreatic alpha amylase with ab231119 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Pancreatic alpha amylase antibody (ab231119) at 2 µg/ml + Rat pancreas lysate

    Developed using the ECL technique.
  • Anti-Pancreatic alpha amylase antibody (ab231119) at 2 µg/ml + Rat serum

    Developed using the ECL technique.
  • Anti-Pancreatic alpha amylase antibody (ab231119) at 2 µg/ml + Recombinant rat Pancreatic alpha amylase protein

    Developed using the ECL technique.

References

ab231119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up