Overview

  • Product name

    Anti-Pancreatic Lipase/PTL antibody
    See all Pancreatic Lipase/PTL primary antibodies
  • Description

    Rabbit polyclonal to Pancreatic Lipase/PTL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Pancreatic Lipase/PTL aa 60-214.
    Sequence:

    NENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKN LFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYS PSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLD PSDAK


    Database link: P16233

  • Positive control

    • IHC-P: Human panceas tissue.
  • General notes

    Previously labelled as Pancreatic Lipase. 

Properties

Applications

Our Abpromise guarantee covers the use of ab238594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Lipase family.
    Contains 1 PLAT domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • lipase, pancreatic antibody
    • LIPP_HUMAN antibody
    • Pancreatic lipase antibody
    • Pancreatic triacylglycerol lipase antibody
    • PL antibody
    • PNLIP antibody
    • PNLIPD antibody
    • PTL antibody
    • Triacylglycerol acylhydrolase antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for Pancreatic Lipase/PTL using ab238594 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab238594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up