Overview

  • Product name

  • Description

    Rabbit polyclonal to PANDER
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Mouse PANDER aa 30-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLL S


    Database link: Q9D309

  • Positive control

    • Rat pancreas tissue.
  • General notes

    Previously labelled as FAM3B. 

Properties

Applications

Our Abpromise guarantee covers the use of ab216500 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner. Present in insulin secretory granules and likely cosecreted with insulin.
  • Tissue specificity

    Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis.
  • Sequence similarities

    Belongs to the FAM3 family.
  • Post-translational
    modifications

    2 N-termini have been observed in the mature protein: the first at Glu-30, resulting from signal peptide cleavage, the second at Ser-46.
  • Cellular localization

    Secreted. Localized in discrete vesicular and perinuclear structure.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2-21 antibody
    • C21orf11 antibody
    • C21orf76 antibody
    • Cytokine like protein 2 21 antibody
    • Cytokine-like protein 2-21 antibody
    • Fam3b antibody
    • FAM3B_HUMAN antibody
    • Family with sequence similarity 3 member B antibody
    • ORF9 antibody
    • Pancreatic-derived factor antibody
    • PANDER antibody
    • PRED44 antibody
    • Protein FAM3B antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat pancreas tissue labeling PANDER with ab216500 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

References

ab216500 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216500.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up