Overview

  • Product name

  • Description

    Rabbit polyclonal to PANDER
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PANDER aa 67-181.
    Sequence:

    TPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNY VTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNND AKNAIEALGSKEIRN


    Database link: P58499

  • Positive control

    • WB: PANDER overexpressing HEK-293T cell lysate. IHC-P: Human small intestine tissue.
  • General notes

    Previously labelled as FAM3B. 

Properties

Applications

Our Abpromise guarantee covers the use of ab224100 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner. Present in insulin secretory granules and likely cosecreted with insulin.
  • Tissue specificity

    Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis.
  • Sequence similarities

    Belongs to the FAM3 family.
  • Post-translational
    modifications

    2 N-termini have been observed in the mature protein: the first at Glu-30, resulting from signal peptide cleavage, the second at Ser-46.
  • Cellular localization

    Secreted. Localized in discrete vesicular and perinuclear structure.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2-21 antibody
    • C21orf11 antibody
    • C21orf76 antibody
    • Cytokine like protein 2 21 antibody
    • Cytokine-like protein 2-21 antibody
    • Fam3b antibody
    • FAM3B_HUMAN antibody
    • Family with sequence similarity 3 member B antibody
    • ORF9 antibody
    • Pancreatic-derived factor antibody
    • PANDER antibody
    • PRED44 antibody
    • Protein FAM3B antibody
    see all

Images

  • All lanes : Anti-PANDER antibody (ab224100) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : PANDER overexpressing HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
  • Paraffin embedded human small intestine tissue stained for PANDER with ab224100 (1/50) in immunohistochemical analysis.

References

ab224100 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224100.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up