Overview

  • Product name

  • Description

    Rabbit polyclonal to PANG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human PANG aa 310-360 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GRLTYYAKPHWVQLIKDVEIAVEDSLYWECRASGKPKPSYRWLKNGAALV L


    Database link: Q9P232

  • Positive control

    • Rat brain tissue
  • General notes

    Previously labelled as Contactin 3.

Properties

Applications

Our Abpromise guarantee covers the use of ab203592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 if using a fluorescent secondary antibody)

Target

  • Function

    Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity.
  • Tissue specificity

    In brain, it is expressed in frontal lobe, occipital lobe, cerebellum and amygdala.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. Contactin family.
    Contains 4 fibronectin type-III domains.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BIG 1 antibody
    • BIG-1 antibody
    • Brain derived immunoglobulin superfamily protein 1 antibody
    • Brain-derived immunoglobulin superfamily protein 1 antibody
    • Cntn3 antibody
    • CNTN3_HUMAN antibody
    • Contactin 3 antibody
    • Contactin-3 antibody
    • KIAA1496 antibody
    • PANG antibody
    • PCS antibody
    • Plasmacytoma-associated neuronal glycoprotein antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat brain tissue labeling PANG with ab203592 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up