Overview

  • Product name

  • Description

    Rabbit polyclonal to Pannexin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Pannexin 1 aa 228-411. (Expressed in E.coli).
    Sequence:

    CIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLS VINLVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYND LSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDV VDGKTPMSAEMREEQGNQTAELQGMNIDSETKAN


    Database link: Q96RD7

  • Positive control

    • IHC-P: Human liver, liver cancer and kidney tissues. WB: SK-N-SH and U-87 MG cell lysates; Recombinant human Pannexin 1 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233479 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 48 kDa.

Target

Images

  • Paraffin-embedded human liver tissue stained for Pannexin 1 using ab233479 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver cancer tissue stained for Pannexin 1 using ab233479 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for Pannexin 1 using ab233479 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Pannexin 1 antibody (ab233479) at 3 µg/ml + Recombinant human Pannexin 1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 48 kDa

  • All lanes : Anti-Pannexin 1 antibody (ab233479) at 3 µg/ml

    Lane 1 : SK-N-SH (human neuroblastoma cell line) cell lysate
    Lane 2 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 48 kDa

References

ab233479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up