Overview

  • Product name

  • Description

    Rabbit polyclonal to PAOX/PAO
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PAOX/PAO aa 130-356. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    IERTREFLNESETPMASVGEFLKKEISQQVASWTEDDEDTRKRKLAILNT FFNIECCVSGTHSMDLVALAPFGEYTVLPGLDCILAGGYQGLTDRILASL PKDTVAFDKPVKTIHWNGSFQEAAFPGETFPVLVECEDGARLPAHHVIVT VPLGFLKEHQDTFFEPPLPAKKAEAIKKLGFGTNNKIFLEFEEPFWEPDC QFIQVVWEDTSPLQDTALSLQDTWFKK


    Database link: Q8C0L6

  • Positive control

    • WB: Mouse pancreas lysate; Recombinant mouse PAOX/PAO protein. IHC-P: Mouse testis tissue.
  • General notes

     This product was previously labelled as PAOX

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. It does not oxidize spermidine. PAOX plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs. There are eleven named isoforms.
  • Cellular localization

    Peroxisome. Cytoplasm.
  • Database links

  • Alternative names

    • DKFZp434J245 antibody
    • MGC45464 antibody
    • PAO antibody
    • Peroxisomal N(1) acetyl spermine/spermidine oxidase antibody
    • Peroxisomal N1 acetyl spermine/spermidine oxidase antibody
    • Polyamine oxidase (exo N4 amino) antibody
    • Polyamine oxidase antibody
    • RP11 122K13.11 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for PAOX/PAO using ab233476 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PAOX/PAO antibody (ab233476) at 3 µg/ml + Mouse pancreas tissue lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 2000 mg/ml
  • Anti-PAOX/PAO antibody (ab233476) at 3 µg/ml + Recombinant mouse PAOX/PAO protein

References

ab233476 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up