Overview

  • Product name

  • Description

    Rabbit polyclonal to PAOX/PAO
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human PAOX/PAO aa 398-447 (C terminal). (AAS64381.1)
    Sequence:

    EVLLCLTQVLRRVTGNPRLPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGG

  • Positive control

    • Fetal muscle lysate
  • General notes

     This product was previously labelled as PAOX

     

Properties

Applications

Our Abpromise guarantee covers the use of ab84951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 56 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. It does not oxidize spermidine. PAOX plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs. There are eleven named isoforms.
  • Cellular localization

    Peroxisome. Cytoplasm.
  • Database links

  • Alternative names

    • DKFZp434J245 antibody
    • MGC45464 antibody
    • PAO antibody
    • Peroxisomal N(1) acetyl spermine/spermidine oxidase antibody
    • Peroxisomal N1 acetyl spermine/spermidine oxidase antibody
    • Polyamine oxidase (exo N4 amino) antibody
    • Polyamine oxidase antibody
    • RP11 122K13.11 antibody
    see all

Images

  • Anti-PAOX/PAO antibody (ab84951) at 1 µg/ml + Human fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 56 kDa



    The observed band corresponds to isoform 7 (25kDa).

References

ab84951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up