Overview

  • Product name

  • Description

    Rabbit polyclonal to PAPP A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human PAPP A aa 1370-1420 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    GSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPP P


    Database link: Q13219

  • Positive control

    • Mouse embryo tissue

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 180 kDa.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200

Target

  • Function

    Metalloproteinase which specifically cleaves IGFBP-4 and IGFBP-5, resulting in release of bound IGF. Cleavage of IGFBP-4 is dramatically enhanced by the presence of IGF, whereas cleavage of IGFBP-5 is slightly inhibited by the presence of IGF.
  • Tissue specificity

    High levels in placenta and pregnancy serum. In placenta, expressed in X cells in septa and anchoring villi, and in syncytiotrophoblasts in the chorionic villi. Lower levels are found in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow, colon, fibroblasts and osteoblasts.
  • Sequence similarities

    Belongs to the peptidase M43B family.
    Contains 5 Sushi (CCP/SCR) domains.
  • Developmental stage

    Present in serum and placenta during pregnancy; levels increase throughout pregnancy.
  • Post-translational
    modifications

    There appear to be no free sulfhydryl groups.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ASBABP2 antibody
    • Aspecific BCL2 ARE binding protein 2 antibody
    • Differentially placenta 1 expressed protein antibody
    • DIPLA1 antibody
    • EC 3.4.24.79 antibody
    • IGF dependent IGFBP 4 protease antibody
    • IGF-dependent IGFBP-4 protease antibody
    • IGFBP 4ase antibody
    • IGFBP-4ase antibody
    • IGFBP4ase antibody
    • Insulin like growth factor dependent IGF binding protein 4 protease antibody
    • Insulin-like growth factor-dependent IGF-binding protein 4 protease antibody
    • PAPA antibody
    • PAPP A antibody
    • PAPP-A antibody
    • PAPP1_HUMAN antibody
    • PAPPA antibody
    • PAPPA1 antibody
    • Pappalysin 1 precursor antibody
    • Pappalysin-1 antibody
    • Pregnancy Associated Plasma Protein A antibody
    • Pregnancy associated plasma protein A pappalysin 1 antibody
    • Pregnancy-associated plasma protein A antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse embryo tissue labeling PAPP A with ab203683 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up